DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Spn42Db

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster


Alignment Length:370 Identity:125/370 - (33%)
Similarity:205/370 - (55%) Gaps:21/370 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGAR--AKTAQEMRNVLKLPD-DKKEVAAKY 77
            :||...:..|.:.:|..|:|.||||:.|:.:|..||..  :.||:||...|:... :.::||..:
  Fly    12 QFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQVAESF 76

  Fly    78 KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWV 142
            ..:   |:..|:...|.:||.:||.|..|:...:..:::..|.::...||. ...:|:||:|.||
  Fly    77 GVV---LKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF-GSEQAASIINKWV 137

  Fly   143 DNQTRGKIKDLVSSNDMSK-MELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLF 206
            ::||...|||::....::| ..|.::|.|:|||:|...||.|.|::.:|..|| :...|.||.:.
  Fly   138 ESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSD-RPTRVRMMHVC 201

  Fly   207 QSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKK-------IVGFKPKLSKMDVT 264
            ::|..|......|..:.:.|...:|:|:|.|||:...|:.||||       :|.....|.|:|| 
  Fly   202 ENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEKVDV- 265

  Fly   265 LRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVEN-SNVHVKKVIHKAFIEVNEEGAEAAA 328
             ::|.|..||..:|::||:.||:...|...|:...:::: .::.|.:::||||||:||.|.||||
  Fly   266 -KIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAA 329

  Fly   329 ATALLFVRYSMP-MPSSQMVFNADHPFAYVIRDR-ETIYFQGHFV 371
            |||.:....||| ......||:|:.||.|.|:|. ..:.|.|||:
  Fly   330 ATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHGLLFAGHFI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 123/367 (34%)
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 123/367 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446355
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
99.000

Return to query results.
Submit another query.