DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Spn28B

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster


Alignment Length:378 Identity:183/378 - (48%)
Similarity:250/378 - (66%) Gaps:7/378 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKHLCLLLLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLK 65
            ||:|.||||||||...|.:|||::||.:||..|||.||:|.||.:||.||.:..||.:|:|||||
  Fly     1 MKYLYLLLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLK 65

  Fly    66 LPDDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVD 130
            ..::|..||..|:.|||.|:.||....|.:|||||||||:.|||.:||:.:.:|.|:|::|.:.|
  Fly    66 FSENKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDD 130

  Fly   131 PNKASSIVNNWVDNQTRGKIKDLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSD 194
            |..||:|||:|:.|:|||.|:::|...|. |.....::|||||||||.|.|....|...:|.||.
  Fly   131 PVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSA 195

  Fly   195 QKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPKLS 259
            .:.:||:||:|..|..:.:..::.||||||||.||:|||.|.||:.||||.:|::|:......|.
  Fly   196 NEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHLE 260

  Fly   260 KMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGA 324
            |..|.::|||||||..|||..:...:||.|.|:.|||...||..|...:.|::.|||::::|:|.
  Fly   261 KKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGG 325

  Fly   325 EAAAATALLFVRY----SMPMPSSQMVFNADHPFAYVIRDRETIYFQGHFVKP 373
            ||:|||.:|..|.    ::..|  .|.|.|||||.|||.|.:.||||||.|:|
  Fly   326 EASAATGVLTRRKKSIDNLIQP--PMEFIADHPFFYVIHDNKVIYFQGHIVEP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 169/360 (47%)
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 169/357 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468692
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
1110.900

Return to query results.
Submit another query.