DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina7

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:376 Identity:101/376 - (26%)
Similarity:182/376 - (48%) Gaps:17/376 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVL--KLPDDK-KEV 73
            |::..||...|:.|:.||...|:..||:|:.:||:|...|:.:.|..::..||  .|.|.. .|:
Mouse    55 SINADFAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVLGFNLTDTPVTEL 119

  Fly    74 AAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIV 138
            ...::.|:..|...:....|.:.|.:::.::.:.:..:...||..:..|..:.|..:.:.|...:
Mouse   120 QQGFQHLICSLNFPKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHKI 184

  Fly   139 NNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFN-PKLTKKRNFRVSDQKSVPVEM 202
            |::|:.||:|||..|:....:: :.:|::|.|:|:.||...|. .|..:..||.|....:|.|.|
Mouse   185 NSYVEKQTKGKIVGLIQGLKLN-IIMILVNYIHFRAQWANPFRVSKTEESSNFSVDKSTTVQVPM 248

  Fly   203 MSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSE------LEKKIVGFKPKLSKM 261
            |...:.:....|.||...::::.|..::|::.: ||.  :|..|      ..|.:..:...|.|.
Mouse   249 MHQLEQYYHYVDMELNCTVLQMDYSENALALFV-LPK--EGHMEWVEAAMSSKTLKKWNYLLQKG 310

  Fly   262 DVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEA 326
            .|.|.:|||.|.....|...|..||::|||.:||||..:.|:|.:.:....|||.:.:.|||.:.
Mouse   311 WVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITEDSGLKLSYAFHKAVLHIGEEGTKE 375

  Fly   327 AAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKPNE 375
            .|:..:..:. ...:|....|...|..|..:|.::.|  :.|.|..|.|.:
Mouse   376 GASPEVGSLD-QQEVPPLHPVIRLDRAFLLMILEKRTRSVLFLGKLVNPTK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 98/367 (27%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 97/366 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.