DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Spn28Db

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster


Alignment Length:378 Identity:135/378 - (35%)
Similarity:216/378 - (57%) Gaps:13/378 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKHLCLLLLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLK 65
            :|:|.|||:||||..:|..:..:|: .:.|.:|.|:|||.:||.:||..|||:..||:|:|:||.
  Fly     7 IKYLVLLLIATSVLGKFKLNLLELV-MDKAESNFIASPLCIEIGISMILMGAKGTTAEELRSVLD 70

  Fly    66 LPDDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVD 130
            ||.|..|:|.||:.::|..   :|...|...|.:|||:.:::...||.::|.:||||.:  |.:.
  Fly    71 LPVDVTEMAKKYERIMSNF---QKHNGLRFTNWLYVNETYEVRQDYNTLMKSTFMAEGK--DPLS 130

  Fly   131 PNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKKRNFRVSD 194
            ..|||:.::..:..::...::.:.:.:::...|..|| |.:|:.|.|:.:|:.|.||.:.|....
  Fly   131 QRKASNSISFSIHRKSHKGMRTISNDHNLQINESAVLVNTVYYSGAWKTRFSKKDTKLKVFHGDH 195

  Fly   195 QKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPKLS 259
            .|.|.|.|||....||.| |...| :|||:|:.||.|||:|.||.....||.:||.:......|.
  Fly   196 NKKVYVRMMSHVGRFRIA-DHSYG-QIIEMPFDNSDLSMIIGLPLHNTYLSSIEKILRTLSESLV 258

  Fly   260 KMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVEN-SNVHVKKVIHKAFIEVNEEG 323
            :.:|.:.||||||::..:|.:.|..:||...|..::|...|:.| :...:..|:||:|||:||.|
  Fly   259 ENNVHVELPKFKIKYQTELVESLKKLGIHLIFSNTSDLSGLLTNGTGAKINHVVHKSFIEINERG 323

  Fly   324 AEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETIYFQGHFVK-PNE 375
            |....|:.  ..........:...|..:.||.::|||:.|:||:|..|: |||
  Fly   324 ASTGEASD--HAESIQKKTRASTSFKVNRPFVFLIRDKHTVYFRGRVVRLPNE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 122/357 (34%)
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 122/355 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468702
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.