DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpine3

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:380 Identity:97/380 - (25%)
Similarity:173/380 - (45%) Gaps:42/380 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVL----KL 66
            |.||.|    .||...|:..|.|....|.:.||.||.::|.:...|||..|..::...|    :.
Mouse    28 LWLLKT----EFALHLYRSAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAGALGYTVQD 88

  Fly    67 PDDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDP 131
            |..|:.:.|.|....:..:|    ..:.||..:::.....|.|.:.:.|.....:..||.|..:|
Mouse    89 PRVKEFLHAVYTTRHNSSQG----VGMELACTLFMQTGTSLSPCFVEQVSRWANSSLEAADFSEP 149

  Fly   132 NKASSIVNNWVDNQTRGKIKD--LVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSD 194
            |..::..:.....|:.|:..|  |....|....:|.:::.:.|:..|:.:|:..|   :....:.
Mouse   150 NSTTTEASKVTSRQSTGEGPDSPLWGRADALSTQLSIMSTMTFQSTWQKRFSVVL---QPLPFTH 211

  Fly   195 QKSVPVEMMSLFQ-------SFRAAHDSELGAKIIELPYRNSSLSMLIFLP-DQVDGLSELEKKI 251
            ...:.:::.::.|       .|:.|...|:.  ::||.|.....|:|:.|| |:...|..:|..:
Mouse   212 AHGLVLQVPAMHQVAEVSYGQFQDAAGHEIA--VLELLYLGRVASLLLVLPQDKGTPLDHIEPHL 274

  Fly   252 VG-------FKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEK-SADFKDLVENSNVHV 308
            ..       .:.|.::|||.  ||:|||:....:..:|.:.||.|.|:. .|:.|.:......:|
Mouse   275 TARVLHLWTTRLKRARMDVF--LPRFKIQNQFDVKSILRSWGITDLFDPLKANLKGISGQDGFYV 337

  Fly   309 KKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET 363
            .::.|||.:|::|||..::||||:|.:|     .|....|.||.||.:::|:..|
Mouse   338 SQLTHKAKMELSEEGTRSSAATAVLLLR-----RSRTSAFKADRPFIFLLREHST 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 93/372 (25%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 97/380 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.