DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina1f

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:408 Identity:73/408 - (17%)
Similarity:178/408 - (43%) Gaps:51/408 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLLATSV--------------SCR--------FADDFYQLLAKENAANNLISSPLSVEIALS 46
            ||.||..|..              .||        .:...::.:|:.:...|::.||:.|..|:|
  Rat    16 LCCLLPITKTKYEDLYEDPNIDPFQCRKVALTISNISITLFKEMAQLSVNGNILFSPIRVIAAIS 80

  Fly    47 MAYMGARAKTAQEMRNVLK-----LPDDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQ 106
            |..:||:...::.:..:|:     ||:  .|:...::.||..:...|:::.|...:.:::::...
  Rat    81 MLSLGAKGNESKRILEILRLNKTGLPE--AEIHKCFRYLLRAIHQPEQLSPLKSGSGVFIHQDLT 143

  Fly   107 LVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLVSS--NDMSKMELIVLNA 169
            .|..:.:.||:.:.::..:|:..|..:|.:.:||::..::..:||::|.:  ||   ..:.|:|.
  Rat   144 PVDKFVEGVKNLYHSDIVSINFTDCRRAKTQINNYMMTKSNKEIKNIVKNLEND---TYMAVVNY 205

  Fly   170 IYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSML 234
            |.:..:....|..:..|::::.:....::.|.|:.:..........:|.:.::......|:.:..
  Rat   206 IIWNAKINSDFGCRSVKQKDYHLEQGMTIKVPMIHIVDLNHLFRVEDLSSTVLVFTLLASNFTTY 270

  Fly   235 IFLPDQVDGLSELEKKIVGFKPKLSKMD-------VTLRLPKFKIEFFAQLNKVLVAMGIQDAFE 292
            ..:|| :..:.::|:::.  .|...:|.       |.|..|:..:.....:..::..:||...|.
  Rat   271 FIIPD-IGQMQKVEQRLT--YPHFRRMRRQSNLRMVNLETPELSLSETHDVESMMNLLGITYVFN 332

  Fly   293 KSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYV 357
            ..|:...::.::.....|::.|..:.::::|::...:|..   :....:....:.||  .||...
  Rat   333 NDANSSAVMNDTLQKSFKMVSKVKLTIDDKGSKPGRSTCF---KNDGSVDVGYVQFN--RPFLIF 392

  Fly   358 IRD--RETIYFQGHFVKP 373
            |:|  .:...|.|..|.|
  Rat   393 IKDPTNDVPLFLGRVVNP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 66/379 (17%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 65/375 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.