DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and RGD1562844

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:284 Identity:86/284 - (30%)
Similarity:157/284 - (55%) Gaps:13/284 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKA 134
            |.::...::.|..||...|:..:|.:||.|:|:|..:::|::.:.....:.:|.|.:...:..:.
  Rat    13 KGDIHRGFQLLFKKLNKSERYFSLRMANGIFVDKTCEVLPTFKESCLRFYNSEMEQLSFAEAAEE 77

  Fly   135 S-SIVNNWVDNQTRGKIKDLVSSNDMS-KMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKS 197
            | ..||.||..||.|||.:|:..:.:. :..|:::||:|.|..|..:|:...|::..|:::..::
  Rat    78 SRKHVNTWVSKQTEGKIPELLPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTREMPFKINKNET 142

  Fly   198 VPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFK------- 255
            .||:||.....|...:..|:.|.::.:||:...|..|:.|||:...:|::|:::...|       
  Rat   143 RPVQMMYQEGIFCYKYVKEVPASLLMIPYKGDELCFLVLLPDESVDISKVEEELTFEKLTAWTQP 207

  Fly   256 PKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAFIEV 319
            ..:|...|.:.|||||:|....|..:|..:||.||||:: ||...:....|:.|.|.:||:.:||
  Rat   208 DTMSYTHVEVFLPKFKLEEDYDLKSLLQRLGIVDAFEETKADLSAMAPERNLCVSKFVHKSVVEV 272

  Fly   320 NEEGAEAAAATALLFVRYSMPMPS 343
            ||:|.|||||.:.:.:   :|:.|
  Rat   273 NEKGTEAAAAASSVNI---VPLSS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 86/284 (30%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.