DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinc1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:386 Identity:120/386 - (31%)
Similarity:210/386 - (54%) Gaps:31/386 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLA-KENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVA 74
            :..:.|||.:|||.|| .:|..:|:..||||:..|.:|..:||...|.:::..|.|.....::.:
  Rat    85 SKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNNTLKQLMEVFKFDTISEKTS 149

  Fly    75 AKYKDLLSKLEGR-----EKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVD-PNK 133
            .:.....:||..|     .|.:.|..|||::.:|......||..:.:..:.|:.:.:|..: |.:
  Rat   150 DQIHFFFAKLNCRLYRKANKSSNLVSANRLFGDKSLTFNESYQDVSEIVYGAKLQPLDFKENPEQ 214

  Fly   134 ASSIVNNWVDNQTRGKIKDLVSSNDMSKM-ELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKS 197
            :...:||||.|:|.|:|||::....:.:: .|:::|.|||||.|:.||:|:.|:|..|...|.:|
  Rat   215 SRVTINNWVANKTEGRIKDVIPQGAIDELTALVLVNTIYFKGLWKSKFSPENTRKEPFHKVDGQS 279

  Fly   198 VPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIV-----GFKPK 257
            ..|.||.....|:.....| |.:::|:|::...::|::.||.....|:::|:::.     .:..:
  Rat   280 CLVPMMYQEGKFKYRRVGE-GTQVLEMPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEWLDE 343

  Fly   258 LSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAF--EKS------ADFKDLVENSNVHVKKVIHK 314
            ||::.:.:.:|:|:||....|.:.|..||:.|.|  |||      |:.:|     ::.|....||
  Rat   344 LSEVMLVVHVPRFRIEDSFSLKEQLQDMGLVDLFSPEKSQLPGIIAEGRD-----DLFVSDAFHK 403

  Fly   315 AFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRD--RETIYFQGHFVKP 373
            ||:||||||:||||:|:::....|  :..|::.|.|:.||..:||:  ..||.|.|....|
  Rat   404 AFLEVNEEGSEAAASTSVVITGRS--LNPSRVTFKANRPFLVLIREVALNTIIFMGRVSNP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 119/378 (31%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 119/381 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.