DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and LOC299277

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_008763124.2 Gene:LOC299277 / 299277 RGDID:1595900 Length:420 Species:Rattus norvegicus


Alignment Length:382 Identity:112/382 - (29%)
Similarity:179/382 - (46%) Gaps:29/382 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL---PDDKKEV 73
            |::..||...|:.||.:|...|:..||||:..||:...:||:..|.||:...||.   ...:.::
  Rat    49 SINTDFAFSLYKELALKNPNKNIAFSPLSISAALASLSLGAKGNTLQEILEGLKFNLTETTEIDI 113

  Fly    74 AAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIV 138
            ...|:|||.:|........:|.||.::|.|..|::..:.:..|..:..|..|.|.....:|...:
  Rat   114 HQNYRDLLQRLSQPGGQGQISRANLLFVEKHLQILNGFKEKAKALYQTEVFATDFQQTCEARKFI 178

  Fly   139 NNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMM 203
            |::|..|::||||::|:..: .:..:::||.:.|.|||...|:|..|....|.:..::.|.|.||
  Rat   179 NDYVMIQSQGKIKEMVTELE-ERTSIVMLNFLLFTGQWSVPFDPDDTFMGKFILDSRRPVKVLMM 242

  Fly   204 SLFQSFRAAH--DSELGAKIIELPYRNSSLSMLIFLPDQVDGLSE----------LEKKIVGFKP 256
            .. :.....:  |.||...::||.|:....:|.| ||||  |..|          |.|.....||
  Rat   243 KT-EDLTTPYFWDEELKCTVVELNYKGHGKAMFI-LPDQ--GKMEQVEASLHPGTLRKWTDSLKP 303

  Fly   257 KLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNE 321
            ::  :| .|.||||.:....:|..:|..:||.|.|...||...:....:|.|.::||...:.:.|
  Rat   304 RI--ID-ELHLPKFSLSKTYKLENILPELGIMDVFNTQADLSGIAGAKDVRVSQMIHNTVLGMAE 365

  Fly   322 EGAEAAAATALLFVRYSM-PMPSSQMVFNADHPFAYVIRD--RETIYFQGHFVKPNE 375
            .|.||.|.|.   |.|:. |...:....|....|.|::.:  .|.|.|....:.|.|
  Rat   366 TGTEAEATTR---VEYNFRPAKLNDTFVNFVRKFLYMVLEPNSELISFMRKVINPLE 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 109/373 (29%)
LOC299277XP_008763124.2 serpinA3_A1AC 37..417 CDD:381019 110/378 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.