DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina9

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:381 Identity:112/381 - (29%)
Similarity:196/381 - (51%) Gaps:26/381 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKT-AQEMR----NVLKLPDDK 70
            |..:.:||...||.||:::...|::.||:|:..:|:|..:||.:.| .|.:|    |:..:.:  
  Rat    46 TPSNTKFAFLLYQRLAQKSPGQNILFSPVSISTSLAMLSLGACSATKTQILRSLGFNITHIAE-- 108

  Fly    71 KEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS 135
            ..:...::.|:..|....|...|.:.:.:::.|:.||...:...||..:..:..:.|..:...|.
  Rat   109 HTIHLGFEQLVHSLNECHKDLELRMGSVLFIRKELQLQVKFLDRVKKLYGTKVFSEDFSNAVTAQ 173

  Fly   136 SIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKR-NFRVSDQKSVP 199
            :.:|::|:.:|:||:.|::...| |:..::::|.|:||..|...|:...|.|. .|.:|...:|.
  Rat   174 AQINSYVERETKGKVVDVIQDLD-SQTAMVLVNHIFFKANWTQPFSAANTNKSFPFLLSKGTTVH 237

  Fly   200 VEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPK------- 257
            |.||...:||....|.|||..|:::.||..:::..: ||.: ..:.:||:.:   .|:       
  Rat   238 VPMMHQTESFAFGVDRELGCSILQMDYRGDAVAFFV-LPGK-GKMRQLERSL---SPRRLRRWSR 297

  Fly   258 -LSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNE 321
             |.|..:.:.:|||.|.....|..:|..|||:|||..:|||..:.:...:.|.|..|||.::|:|
  Rat   298 SLQKRWIKVFIPKFSISASYNLETILPEMGIRDAFNSNADFSGITKTHFLQVSKAAHKAVLDVSE 362

  Fly   322 EGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDR--ETIYFQGHFVKPNE 375
            ||.||||||....:..|...|||.:.||  .||..::.|:  |:|.|.|....|.:
  Rat   363 EGTEAAAATTTKLIVRSRDTPSSTIAFN--EPFLILLLDKNTESILFLGKVENPRK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 110/371 (30%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 112/381 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.