DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina6

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:392 Identity:110/392 - (28%)
Similarity:193/392 - (49%) Gaps:45/392 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLCLLLLATS---------------------VSCRFADDFYQLLAKENAANNLISSPLSVEIALS 46
            :.|||.|.||                     .:..||.:.||.|...|...|.:.||:|:.:||:
  Rat     6 YTCLLWLCTSGLWTAQASTNESSNSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALA 70

  Fly    47 MAYMG-ARAKTAQEMR-NVLKLPDDKKEVAAKYKDLLSKLE--GREKVATLSLANRIYVNKKFQL 107
            |..:| |:.::.|.:. |:.:..:.:...:.:|.:.|.|..  |.|    :::.|.:::.:|.:|
  Rat    71 MVSLGSAQTQSLQSLGFNLTETSEAEIHQSFQYLNYLLKQSDTGLE----MNMGNAMFLLQKLKL 131

  Fly   108 VPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYF 172
            ..|:...||..:.:||.|||..|..|||..:|..|.::|:|||:.:.|..| |....|::|.|:.
  Rat   132 KDSFLADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVFSDLD-SPASFILVNYIFL 195

  Fly   173 KGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFL 237
            :|.||..|:|:.|::.:|.|::..:|.|.||....|.....||....::|::.|..:..:..| |
  Rat   196 RGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDYVGNGTAFFI-L 259

  Fly   238 PD--QVDG-LSELEKKIVGFKPKL-SKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFK 298
            ||  |:|. ::.|.:..:....|| :...|.|.:|||.|.....|..:|..:.|:|.....:||.
  Rat   260 PDQGQMDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTNQSDFS 324

  Fly   299 DLVENSNVHVKKVIHKAFIEVNEEGAEAAAAT--ALLFVRYSMPMPSSQMVFNADHPFAYVIRDR 361
            ...::..:.: .::|||.::: :||.....:|  |.|.:| |.|:   .:.||  .||..::.|:
  Rat   325 GNTKDVPLTL-TMVHKAMLQL-DEGNVLPNSTNGAPLHLR-SEPL---DIKFN--KPFILLLFDK 381

  Fly   362 ET 363
            .|
  Rat   382 FT 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 104/360 (29%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 104/361 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.