DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serping1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_954524.1 Gene:Serping1 / 295703 RGDID:735225 Length:504 Species:Rattus norvegicus


Alignment Length:377 Identity:92/377 - (24%)
Similarity:161/377 - (42%) Gaps:57/377 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLLSKLE 85
            ::...|.:.|..|:..||.|:...|:...:||...|...:.::|..|.|...|....|...||  
  Rat   159 YHAFSATKKAETNMAFSPFSIASLLTQVLLGAGDSTKSNLEDILSYPKDFACVHQTLKAFSSK-- 221

  Fly    86 GREKVATL----SLANR-IYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQ 145
            |...|:.:    .||.| .|||....|..|..:::..            |.:....::|.||...
  Rat   222 GVTSVSQIFHSPDLAIRDTYVNASLSLYGSSPRVLGP------------DGDANLKLINTWVAEN 274

  Fly   146 TRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPK------LTKKRNFRVS--DQKSVPVEM 202
            |..||.:|:.|.. |...|::|||:|...:|:..|..|      |.|....:|.  ..|..|   
  Rat   275 TNHKINELLDSLP-SDTRLVLLNAVYLSAKWKKTFEQKKMMASFLYKNSMIKVPMLSSKKYP--- 335

  Fly   203 MSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQ-VDGLSELEKKI--VGFKPKLSKMDVT 264
            ::||      :|..|.||:.:|.. :.:||.:|.:|.. ...|.::||.:  ..||..|.|::::
  Rat   336 LALF------NDQTLKAKVGQLQL-SHNLSFVIMVPQSPTHQLEDMEKALNPTVFKAILKKLELS 393

  Fly   265 ------LRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEG 323
                  :.:|:.|::....:..::..:...| |....:...|.|:.::.|..:.|:..:|:.|.|
  Rat   394 KFQPTYVMMPRIKVKSSQDMLSIMEKLEFFD-FTYDLNLCGLTEDPDLQVSSMKHETVLELTETG 457

  Fly   324 AEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETIY--FQGHFVKP 373
            .|||||:.:...|       :.::|....||.:::.|:...:  |.|....|
  Rat   458 VEAAAASTISVAR-------NLLIFEVQQPFLFLLWDQRHKFPVFMGRVYDP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 91/372 (24%)
Serping1NP_954524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132
SERPIN 150..499 CDD:294093 91/372 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.