DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinh1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_058869.2 Gene:Serpinh1 / 29345 RGDID:69302 Length:417 Species:Rattus norvegicus


Alignment Length:409 Identity:108/409 - (26%)
Similarity:182/409 - (44%) Gaps:48/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLLATSV---------------------------SCRFADDFYQLLAKENAANNLISSPLSV 41
            ||||.:|.:.                           |...|...||.:||:.|..|::.|||.|
  Rat     9 LCLLAVALAAEVKKPVEATAPGTAEKLSSKATTLAERSTGLAFSLYQAMAKDQAVENILLSPLVV 73

  Fly    42 EIALSMAYMGARAKTAQEMRNVL---KLPDDKKEVAAKYKDLLSKL-EGREKVATLSLANRIYVN 102
            ..:|.:..:|.:|.||.:.:.||   ||.|:  ||.....:||..| ....:..|..|.:|:|..
  Rat    74 ASSLGLVSLGGKATTASQAKAVLSAEKLRDE--EVHTGLGELLRSLSNSTARNVTWKLGSRLYGP 136

  Fly   103 KKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL 167
            ........:.:..|..:..|...|:..|...|...:|.|....|.||:.::....:.:...|:| 
  Rat   137 SSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWASQTTDGKLPEVTKDVERTDGALLV- 200

  Fly   168 NAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLS 232
            ||::||..|:.||:.|:...|.|.|:...:|.|.||.....:....|.:...:::|:|..:...|
  Rat   201 NAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYNYYDDEKEKLQLVEMPLAHKLSS 265

  Fly   233 MLIFLPDQVDGLSELEK-----KIVGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFE 292
            ::|.:|..|:.|..|||     ::..:..|:.|..|.:.|||..:|....|.|.|..:|:.:|.:
  Rat   266 LIILMPHHVEPLERLEKLLTKEQLKTWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAID 330

  Fly   293 KS-ADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAY 356
            |: ||...:....::::..|.|....|.:.||......   ::.|..:..|.   :|.|||||.:
  Rat   331 KNKADLSRMSGKKDLYLASVFHATAFEWDTEGNPFDQD---IYGREELRSPK---LFYADHPFIF 389

  Fly   357 VIRDRE--TIYFQGHFVKP 373
            ::||.:  ::.|.|..|:|
  Rat   390 LVRDNQSGSLLFIGRLVRP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 101/367 (28%)
Serpinh1NP_058869.2 serpinH1_CBP1 35..416 CDD:381003 103/383 (27%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.