DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb1a

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001026812.1 Gene:Serpinb1a / 291091 RGDID:1306203 Length:379 Species:Rattus norvegicus


Alignment Length:379 Identity:127/379 - (33%)
Similarity:211/379 - (55%) Gaps:20/379 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAA 75
            :|.:..||.:.:..|::.:...|:..||.|:..||:|.::|.:..||.::...... |..::|.:
  Rat     5 SSANSLFALELFHTLSESSPTGNIFFSPFSISSALAMVFLGTKGTTAAQLSKTFHF-DSVEDVHS 68

  Fly    76 KYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNK-ASSIVN 139
            :::.|.:::..|....||.||||:|..|.:..:|.:....:..:.|:...:|....:: |...:|
  Rat    69 RFQSLNAEVSKRGASHTLKLANRLYGEKTYNFLPEFLTSTQKMYGADLAPVDFQHASEDARKEIN 133

  Fly   140 NWVDNQTRGKIKDLVSSNDMSKM-ELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMM 203
            .||..||.|||.:|::...:..| :|:::|||||||.||.||..:.|....||::.:.:..|:||
  Rat   134 QWVKGQTEGKIPELLAVGVVDSMTKLVLVNAIYFKGMWEEKFMKQDTTDAPFRLNKKNTKSVKMM 198

  Fly   204 SLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVD----GLSELEKKIVGFK-------PK 257
            ...:.|...:.|:|..|::|:||:...|||:|.||:.::    ||.::|::|...|       ..
  Rat   199 YQKKKFFFGYISDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLKKIEEQITLEKLREWTKREN 263

  Fly   258 LSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAFIEVNE 321
            |..:||.::||:||||....||..|..:|:||.|..| ||...:..:.::.:.|::||||:||||
  Rat   264 LENIDVHVKLPRFKIEESYILNSNLGRLGLQDLFNSSKADLSGMSGSRDLFISKIVHKAFVEVNE 328

  Fly   322 EGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            ||.|||||||.: ..:.|.:|..:  |.|||||.:.||...|  :.|.|....|
  Rat   329 EGTEAAAATAGI-ATFCMLLPEEE--FTADHPFIFFIRHNPTANVLFLGRVCSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 125/371 (34%)
Serpinb1aNP_001026812.1 SERPIN 4..379 CDD:294093 126/377 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.