DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb6a

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_006253933.1 Gene:Serpinb6a / 291085 RGDID:735108 Length:400 Species:Rattus norvegicus


Alignment Length:365 Identity:128/365 - (35%)
Similarity:202/365 - (55%) Gaps:25/365 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDK------KEVAAKYKDLLSKLEG 86
            |:::||:..||:|:..||:|.:|||:..||.:|...|.|  ||      .:|...::.||:::..
  Rat    42 EDSSNNIFLSPISISAALTMVFMGAKGMTASQMVQTLSL--DKCSGNGGGDVHQGFQSLLAEVNK 104

  Fly    87 REKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIV-DPNKASSIVNNWVDNQTRGKI 150
            ......|..|||::..|...::.|:....:..:.||.|.:|.. |..::...:|.||..:|..||
  Rat   105 TGTQYLLKTANRLFGEKTCDILASFKDACRKFYEAEMEELDFKGDTEQSRQRINTWVAKKTEDKI 169

  Fly   151 KDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHD 214
            |:|::...:....::|| |||||||.|:.:||.:.|:::.|:||..:..||:||.:..:|:..:.
  Rat   170 KELLAPGIVDPDTVLVLVNAIYFKGNWDKQFNKEHTREKPFKVSKTEEKPVQMMFMKSTFKMTYI 234

  Fly   215 SELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFK-------PKLSKMDVTLRLPKFKI 272
            .|:..||:.|||..:.|:|:|.|||:...|..:||::...|       ..|.:.:|.:.||:||:
  Rat   235 GEIFTKILLLPYAGNELNMIIMLPDEHIELKTVEKELTYEKFIEWTRLDMLDEEEVEVFLPRFKL 299

  Fly   273 EFFAQLNKVLVAMGIQDAF-EKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAAT-ALLFV 335
            |....:..||..:|:.||| |..|||..:.....:.:.|||||||:||||||.||.||| :.:.:
  Rat   300 EENYDMKVVLGKLGMTDAFMEGRADFSGIASKQGLFLSKVIHKAFVEVNEEGTEAVAATGSTITM 364

  Fly   336 RYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            |.....|.    |.|||||.:.|:..:|  |.|.|.|..|
  Rat   365 RCLRFTPR----FLADHPFLFFIQHVKTKGILFCGRFSSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 126/360 (35%)
Serpinb6aXP_006253933.1 SERPIN 25..400 CDD:294093 127/363 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.