DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb8

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:385 Identity:125/385 - (32%)
Similarity:206/385 - (53%) Gaps:22/385 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKHLCLLLLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLK 65
            |..||      ..:..||....::|.:|:.:.||...|:||..||:|.|:||:..||.:|..||.
  Rat     1 MDDLC------EANGSFAISLLKILGEEDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLG 59

  Fly    66 LPDDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIV- 129
            |..| .:|...::.||:::........|..|.|::..:....:.::.:..:..:.|..|.:..| 
  Rat    60 LSGD-GDVHQGFQTLLAEVNKSGTQYLLKSACRLFGEESCDFLSTFKESCQKFYQAGIEEMSFVK 123

  Fly   130 DPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKM-ELIVLNAIYFKGQWEYKFNPKLTKKRNFRVS 193
            |.......:|:||..:|.|||.:::|...:..: :|:::||:||||:|:.:|:.|.|:...|:.:
  Rat   124 DTEGCRKRINDWVLEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTN 188

  Fly   194 DQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPK- 257
            .::...|:||.....|:.||..|:.|:::.|||....|||::.|||:...|:.:||.:...|.: 
  Rat   189 QEEKKTVQMMFKHAKFKMAHVDEVNAQVLALPYAEDELSMVVLLPDESSDLTVVEKALTYEKLRA 253

  Fly   258 ------LSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKA 315
                  |::..|.:..|:.|:|....|..||.::|:.||||:: |||..:....||.|.||.||.
  Rat   254 WTNPETLTESKVQVFFPRLKLEESYDLETVLQSLGMTDAFEETKADFSGMTSKKNVPVSKVAHKC 318

  Fly   316 FIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            |:||||||.||||.||::....|..:   :..|.||.||.:.|..::|  |.|.|.|..|
  Rat   319 FVEVNEEGTEAAATTAVIRNTRSCRI---EPRFCADRPFLFFIWHQKTSSILFCGRFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 120/367 (33%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 123/380 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.