DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinf1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:395 Identity:119/395 - (30%)
Similarity:193/395 - (48%) Gaps:61/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR-----NVLKLPD 68
            ||.:|| .|..|.|:|.:...:..|::.|||||..|||...:||..:|...:.     :::..||
  Rat    54 LAAAVS-NFGYDLYRLRSGAVSTGNILLSPLSVATALSALSLGAEQRTESVIHRALYYDLINNPD 117

  Fly    69 DKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAE--------- 124
                :.:.||:||:.:...||  ....|:||...:|.:        ||.||:|..|         
  Rat   118 ----IHSTYKELLASVTAPEK--NFKSASRIVFERKLR--------VKSSFVAPLEKSYGTRPRI 168

  Fly   125 -----AIDIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPK 183
                 .||:.:       :||||..|.:|||..  |:.:| |.:.:::|...||||||..||:.:
  Rat   169 LTGNPRIDLQE-------INNWVQAQMKGKIAR--STREMPSALSILLLGVAYFKGQWATKFDSR 224

  Fly   184 LTKKRNFRVSDQKSVPVEMMSLFQS-FRAAHDSELGAKIIELPYRNSSLSMLIFLPDQV-DGLSE 246
            .|..::|.:.:.::|.|.|||..:: .|...||:|..||.:||. ..|:|::.|||..| ..|:.
  Rat   225 KTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLPL-TGSMSIIFFLPLTVTQNLTM 288

  Fly   247 LEKKIVG-----FKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNV 306
            :|:.:..     ...:|..:...|.:||.|:.:...:...|..|.:|..|| |.||.. :....|
  Rat   289 IEESLTSEFVHDIDRELKTIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLFE-SPDFSK-ITGKPV 351

  Fly   307 HVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGH 369
            .:.:|.|:|..|.|||||..::...|..||.:.|:.     ::.:.||.:|:||.:|  :.|.|.
  Rat   352 KLTQVEHRAAFEWNEEGAGTSSNPDLQPVRLTFPLD-----YHLNRPFIFVLRDTDTGALLFIGR 411

  Fly   370 FVKPN 374
            .:.|:
  Rat   412 ILDPS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 115/384 (30%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 118/392 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.