DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and AT2G35555

DIOPT Version :10

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001323897.1 Gene:AT2G35555 / 28718328 AraportID:AT2G35555 Length:122 Species:Arabidopsis thaliana


Alignment Length:119 Identity:31/119 - (26%)
Similarity:57/119 - (47%) Gaps:44/119 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 LRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAA 329
            |::|:||.:|..:.::.|..:|::            |.::      :|||:.|||:|.|::||||
plant    28 LKIPRFKFDFGFEASEALKGLGLE------------VPST------IIHKSCIEVDEVGSKAAAA 74

  Fly   330 TALLFV---------RYSMPMPSSQMVFNADHPFAYVIRDRETIYFQGHFVKPN 374
             |::||         :|:: :...|            ::|..||   .:.|.||
plant    75 -AVIFVGCCGPAEKRKYTL-LQGKQ------------VKDTSTI---ANTVLPN 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 serpin42Dd-like_insects 12..373 CDD:381070 29/116 (25%)
AT2G35555NP_001323897.1 serpin <1..89 CDD:476815 23/79 (29%)

Return to query results.
Submit another query.