DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina5

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_766541.2 Gene:Serpina5 / 268591 MGIID:107817 Length:405 Species:Mus musculus


Alignment Length:368 Identity:104/368 - (28%)
Similarity:185/368 - (50%) Gaps:19/368 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL-----PDDKKEVAAK 76
            ||...|:.|..|:...|:..|||||.::|.|..:||..||..::.:.|.|     .:||  :...
Mouse    46 FAFRLYRALVSESPGQNVFFSPLSVSMSLGMLSLGAGLKTKTQILDGLGLSLQQGQEDK--LHKG 108

  Fly    77 YKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNW 141
            ::.||.:.........|||.:.::.:....:...:...:|..:|::..:.:..:|..|...:||:
Mouse   109 FQQLLQRFRQPSDGLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPEIAKKQINNY 173

  Fly   142 VDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLF 206
            |..||:|||.|.:...|.:.: :||:|.|:||.:|:..|:...|.|.:|.|:.:::..|.||:..
Mouse   174 VAKQTKGKIVDFIKDLDSTHV-MIVVNYIFFKAKWQTAFSETNTHKMDFHVTPKRTTQVPMMNRE 237

  Fly   207 QSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQ------VDGLSELEKKIVGFKPKLSKMDVTL 265
            ..:....|..:...::.:||:.:::::.| ||.:      .|||.  |:.:..:....:|..:.|
Mouse   238 DGYSYYLDQNISCTVVGIPYQGNAIALFI-LPSEGKMKQVEDGLD--ERTLRNWLKMFTKRRLDL 299

  Fly   266 RLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAAT 330
            .||||.||...:|..||..:||||.|...||...:.:::|:.:.:::||:.:||.|.|..|||.|
Mouse   300 YLPKFSIEATYKLENVLPKLGIQDVFTTHADLSGITDHTNIKLSEMVHKSMMEVEESGTTAAAIT 364

  Fly   331 ALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETIYFQGHFVKP 373
            ..:|. :....||| :......||...:.:...|.|.|...:|
Mouse   365 GAIFT-FRSARPSS-LKIEFTRPFLLTLMEDSHILFVGKVTRP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 103/363 (28%)
Serpina5NP_766541.2 serpinA5_PCI 42..405 CDD:381021 103/366 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.