DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINA11

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:385 Identity:103/385 - (26%)
Similarity:188/385 - (48%) Gaps:38/385 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR-----NVLKLPDDK 70
            |.....||...|:.||.: |..|:..||:|:...|::..:||:|.|:..:.     |:.:.|:  
Human    51 TPTITNFALRLYKELAAD-APGNIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPE-- 112

  Fly    71 KEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS 135
            .::...::.||..|........|.:.|.::::|:.:....|...:|:.:.|.|.:.:..|.....
Human   113 ADIHQGFRSLLHTLALPSPKLELKVGNSLFLDKRLKPRQHYLDSIKELYGAFAFSANFTDSVTTG 177

  Fly   136 SIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKKR-NFRVSDQKSV 198
            ..:|:::..||.|::.|.:.  :.|:...:|| |.|:||.:|::.|:...|:|: :|.|.::.|:
Human   178 RQINDYLRRQTYGQVVDCLP--EFSQDTFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSL 240

  Fly   199 PVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPD-----QVDGLSE---LEKKIVGFK 255
            .|.||...:..|..:|.:|...::::.||.::|::|: |||     ||:...:   |.|......
Human   241 QVPMMHQKEMHRFLYDQDLACTVLQIEYRGNALALLV-LPDPGKMKQVEAALQPQTLRKWGQLLL 304

  Fly   256 PKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVN 320
            |.|    :.|.||:|.|.....|..:|..:|:.:.....|||..:....|..:.||.|||.::::
Human   305 PSL----LDLHLPRFSISGTYNLEDILPQIGLTNILNLEADFSGVTGQLNKTISKVSHKAMVDMS 365

  Fly   321 EEGAEAAAATALLFVRYSMP-----MPSSQMVFNADHPFAYVIRD--RETIYFQGHFVKP 373
            |:|.||.||:.||    |.|     |......||  .||..::.:  .:::.|.|..|.|
Human   366 EKGTEAGAASGLL----SQPPSLNTMSDPHAHFN--RPFLLLLWEVTTQSLLFLGKVVNP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 100/377 (27%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 100/378 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.