DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:372 Identity:106/372 - (28%)
Similarity:194/372 - (52%) Gaps:28/372 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR-----NVLKLPDDKKEVAAK 76
            ||...|:.|..::..:|:..||:|:..|.:|..:|::..|.:::.     |:.::|:  .::...
  Rat    51 FAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPE--ADIHKA 113

  Fly    77 YKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNW 141
            :..||..|...:....|:..|.::|||..:||..:.:.||:::.:||.:::..|..:|..::|::
  Rat   114 FHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDY 178

  Fly   142 VDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLF 206
            |:..|:|||.||:...|...:..:| |.|:|||:|:..|||:.|:..:|.|....:|.|.||:..
  Rat   179 VEKGTQGKIVDLMKQLDEDTVFALV-NYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRL 242

  Fly   207 QSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDG-LSELEKKIVGFKPKLSKM-------DV 263
            ..|...:.|.|.:.::.:.|..::.::.: |||  || :..||:.:.  |..:|:.       ..
  Rat   243 GMFDMHYCSTLSSWVLMMDYLGNATAIFL-LPD--DGKMQHLEQTLT--KDLISRFLLNRQTRSA 302

  Fly   264 TLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAA 328
            .|..||..|.....|..:|.::||...|...||...:.|::.:.:.:.:|||.:.::|.|.|||.
  Rat   303 ILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAG 367

  Fly   329 ATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            ||.:..|..|:|   .|:.|  ||||.::|.:.||  ..|.|..:.|
  Rat   368 ATVVEAVPMSLP---PQVKF--DHPFIFMIVESETQSPLFVGKVIDP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 105/367 (29%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 105/367 (29%)
RCL 367..386 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.