DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb10

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:309 Identity:98/309 - (31%)
Similarity:159/309 - (51%) Gaps:43/309 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MAYMGARAKTAQEMRNVLKL---------PDDKK------------EVAAKYKDLLSKLEGREKV 90
            |.|:|.:..||.:|..||:.         ||.:|            |:.:.::.|.:::......
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNS 65

  Fly    91 ATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPN-KASSIVNNWVDNQTRGKIKDLV 154
            ..|..|||||..|.:.....|.:.:|..|.||.::::.|:.: :....:|:||.:||.|||.:|:
Mouse    66 YVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLL 130

  Fly   155 SSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELG 218
            ..:.: :|.:::::||:||||.||::|:.|.|.:|.|||:...|.||:|||:.||.:..|..||.
Mouse   131 PDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVFHIEELQ 195

  Fly   219 AKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPKLSK------MD---VTLRLPKFKIEF 274
            ...::|.|:|..||:|:.||:.:|||.:||:.|.  ..||.|      ||   |.|.|||||:|.
Mouse   196 TIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAIT--YEKLDKWTSADMMDTYEVQLYLPKFKMEE 258

  Fly   275 FAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEG 323
            ...|...|........:.|        ||:..|:.. |:.|.::..:.|
Mouse   259 SYDLKSALRGQKFSGPYSK--------ENNEDHLPH-IYSATLDNQQNG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 98/309 (32%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 91/277 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3483
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.