DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb13

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:388 Identity:119/388 - (30%)
Similarity:208/388 - (53%) Gaps:30/388 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVL---------KLP 67
            :.:.:|..|.::.|.|.| ..|:..||:.:..|:.|..:|.|..||.|::.||         ::.
Mouse     6 TAATQFLFDLFKELNKTN-DGNVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIK 69

  Fly    68 DDKKEVAAK------YKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAI 126
            .:::|:..:      .:.||:::........|.::||::..|.:..:..|...|:..:.|..|.:
Mouse    70 SEEEEIEKREEIHHQLQMLLTEISKFSNDYDLIISNRLFGEKTYLFLQKYIDYVEKYYHASLEPV 134

  Fly   127 DIVD-PNKASSIVNNWVDNQTRGKIKDLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKRN 189
            |.|: .:::...:|:||::||..|:|||.....: |..:|:::|.:||||.|:.:|..:.||:.:
Mouse   135 DFVNAADESRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEED 199

  Fly   190 FRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSEL------E 248
            |.::...|.||:||:|..||......:|.|||:.:||:|:.:||.:.||:.:|||.::      |
Mouse   200 FWLNKNLSKPVQMMALCSSFNFTFLEDLQAKIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSPE 264

  Fly   249 KKIVGFKP-KLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVI 312
            |.:....| .|.:..|.||||:.::|....|..||.|:||..||.:.||:..:...|.:|.:..:
Mouse   265 KLVEWTSPGHLEQRRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSGMSARSGLHAQNFL 329

  Fly   313 HKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRE--TIYFQGHFVKP 373
            |::|:.|.|||.||.|.|.   |...:...:|..:.:.:|||.:.||.||  :|.|.|.|..|
Mouse   330 HRSFLVVTEEGVEATAGTG---VGLKVSSAASCELVHCNHPFLFFIRHRESDSILFFGKFSSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 117/381 (31%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 118/386 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.