DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina3j

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:381 Identity:109/381 - (28%)
Similarity:186/381 - (48%) Gaps:23/381 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL---PDD 69
            |...|::..||...|:.||.:|...|.:.||||:.|||:...:||:..|.:|:...||.   ...
Mouse    45 LTLASINTDFAFSLYKKLALKNPHKNFVFSPLSITIALASLSLGAKGNTLEEILEGLKFNLTETP 109

  Fly    70 KKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKA 134
            :.::...:..||.:|........:|..|.:.|.|..|::..:.:..:..:..|....|...|.:|
Mouse   110 EADIHQGFGHLLQRLSQPGDQVQISTGNSMVVEKHLQILAEFKEKARALYHTEVFTADFQQPREA 174

  Fly   135 SSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKS-V 198
            ..::|::|.|||:|.||:|||..: .:..:::.|...|.|:|...|:|..|....| :.|::: |
Mouse   175 RKLLNDYVSNQTQGMIKELVSDLE-ERTSMVMTNFALFNGKWNMTFDPYETFMGTF-IEDRRTPV 237

  Fly   199 PVEMMSLFQSFRAAH--DSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIV-----GFKP 256
            .|.||.: :..||.:  |.::...::||.|:.:..:|.| |||| ..:.::|..:.     |::.
Mouse   238 KVSMMKM-KELRAPYFRDEKMKCTVVELNYKGNGKAMFI-LPDQ-GKMKQVEASLQPATLRGWRK 299

  Fly   257 KL-SKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVN 320
            .| .:|...|.||||.|....:|..:|..:||::.|...||...:....:|.|.::.|.|.:::.
Mouse   300 SLRPRMIDELYLPKFSISKNYRLENILPELGIKEVFSTQADLSGISGGKDVRVSRMFHSAALDMT 364

  Fly   321 EEGAEAAAATALLFVRYS-MPMPSSQMVFNADHPFAYVI--RDRETIYFQGHFVKP 373
            |.|.||.|.|.   .:|. :...|:..|.|.:.||.:.:  .|.|.|.|.|....|
Mouse   365 ETGTEARATTR---DKYDFLSTKSNPTVVNLNTPFLFCVLHSDSENIDFMGKINNP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 106/370 (29%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 108/379 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.