DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina3f

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:377 Identity:118/377 - (31%)
Similarity:195/377 - (51%) Gaps:35/377 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR-----NVLKL 66
            |.||:| :..||...|:.|..:|...|::.||.|:..||::..:||::.|.:|:.     |:.:.
Mouse    35 LTLASS-NTDFAFSLYKELVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTET 98

  Fly    67 PDDKKEVAAKY-KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVD 130
            |:.......:| .||||:...:.:::|   .:.:::.|..|::..:.:..:..:.|||...|...
Mouse    99 PEPDIHQGFRYLLDLLSQPGNQVQIST---GSALFIEKHLQILAEFKEKARALYQAEAFTADFQQ 160

  Fly   131 PNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKKRNFRVSD 194
            |.:|:.::|::|.|.|:||||:|:|  |:.|..|:|| |.|||||:||..|:|..|.|..|.:.:
Mouse   161 PLEATKLINDYVSNHTQGKIKELIS--DLDKRTLMVLVNYIYFKGKWEMPFDPDDTCKSEFYLDE 223

  Fly   195 QKSVPVEMMSL----FQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIV--- 252
            .:||.|.||.:    ...||   |.||...::||.|..::.:|.| |||| ..:.::|..:.   
Mouse   224 NRSVKVPMMKINNLTTPYFR---DEELSCTVVELKYTGNASAMFI-LPDQ-GKMQQVEASLQPET 283

  Fly   253 ------GFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKV 311
                  ..||:|..   .|.||||.|.....|..:|..:||::.|...||...:....::...:|
Mouse   284 LRNWKDSLKPRLIN---ELCLPKFSISTDYSLEHILPELGIRELFSTQADLSAITGTKDLRTSQV 345

  Fly   312 IHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET 363
            :|||.::|.|.|.||||.|....::....:..|..:: .|.||..:|.|..|
Mouse   346 VHKAVLDVAETGTEAAAGTGYQNLQCCQGVIYSMKIY-FDRPFLMIISDTNT 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 114/370 (31%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 115/372 (31%)
RCL 357..382 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.