DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb9d

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_035590.1 Gene:Serpinb9d / 20726 MGIID:894667 Length:377 Species:Mus musculus


Alignment Length:372 Identity:119/372 - (31%)
Similarity:204/372 - (54%) Gaps:20/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL-PDDKKEVAAKYKDL 80
            ||....::|.::|.:.|:..||:|:..||:|..:||:..|..::...|.| ||:  :|...::.|
Mouse    11 FAIHLLKVLCQDNPSENVCFSPMSISSALAMVLLGAKGNTVTQICQALHLNPDE--DVHQGFQLL 73

  Fly    81 LSKLE--GREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS-SIVNNWV 142
            |..|.  ..:|.. |::|||::|....:|:|::.:.....:.:|.|.:...:..:.| ..:|.||
Mouse    74 LHNLNKPNNQKYC-LTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEESRQHINMWV 137

  Fly   143 DNQTRGKIKDLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLF 206
            ..||.|||.||:..:.: |:..||:.||:||:|.|...|....||:..|:::.:::.||:||...
Mouse   138 SKQTNGKIPDLLPKDSIDSQTRLILANALYFQGTWYKLFEKDSTKEMPFKINKKETRPVQMMWQE 202

  Fly   207 QSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELE-----KKIVGF-KPK-LSKMDVT 264
            ..|..|:..|:.|:::.:||....||.::.|||:...:|::|     :|:..: ||. ::.:::.
Mouse   203 DRFYHAYVKEIQAQVLVMPYEGIDLSFVVLLPDKGVDISKVENNLTFEKLTAWTKPDFMNGIELH 267

  Fly   265 LRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAA 328
            :.||||:::....:|.:|..:||.|.|:.| ||...:....|:.:...:||..:||||||.||||
Mouse   268 VYLPKFQLQEDYDMNSLLQHLGILDVFDGSKADLSGMSTKENLCLSNFVHKCVVEVNEEGTEAAA 332

  Fly   329 ATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            |||...::..  :.|....|.|||||.:.|....|  |.|.|.|..|
Mouse   333 ATAGKTIQCC--LGSYPQTFCADHPFLFFIMHSTTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 117/367 (32%)
Serpinb9dNP_035590.1 serpin 1..377 CDD:393296 118/370 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.