DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb5

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001347782.1 Gene:Serpinb5 / 20724 MGIID:109579 Length:375 Species:Mus musculus


Alignment Length:391 Identity:122/391 - (31%)
Similarity:203/391 - (51%) Gaps:43/391 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKK 71
            |.||.|.   ||.|.::.|.:.:.|.|::.||:.:..:||:|.:|.:..||.|:..||.. ::.|
Mouse     4 LRLANSA---FAVDLFKQLCERDPAGNILFSPICLSTSLSLAQVGTKGDTANEIGQVLHF-ENVK 64

  Fly    72 EVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDP-NKAS 135
            :|...::.:.|.:.......:|.|..|:|::|.......:....|..:..|.|.:|..|. .:..
Mouse    65 DVPFGFQTVTSDVNKLSSFYSLKLVKRLYIDKSLNPSTEFISSTKRPYAKELETVDFKDKLEETK 129

  Fly   136 SIVNNWVDNQTRGKIKDLVSSNDMS-KMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVP 199
            ..:|:.:...|.|..:|::|.|.:| :.:::|:||.||.|:|..||....||:..||:|...:.|
Mouse   130 GQINSSIKELTDGHFEDILSENSISDQTKILVVNAAYFVGKWMKKFPESETKECPFRISKTDTKP 194

  Fly   200 VEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLP----DQVDGLSELEKKIVGFKPK--- 257
            |:||:|..:|...:..::..||||||::|..|||||.||    |:..||.::|:::   .|:   
Mouse   195 VQMMNLEATFCLGNIDDISCKIIELPFQNKHLSMLIVLPKDVEDESTGLEKIEQQL---NPETLL 256

  Fly   258 -------LSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAF-EKSADFKDLVENSNVHVKKVIHK 314
                   ::...|.|.|||||:|........|.::|::..| |.::||..:.|...|.:..|||:
Mouse   257 QWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNESTSDFSGMSETKGVSLSNVIHR 321

  Fly   315 AFIEVNEEGAEAAAATALLFVRYSMPMPSSQMV-----FNADHPFAYVIRDRET--IYFQGHFVK 372
            ..:|:.|:|.|            |:.:|.|:::     |||||||.|:||..:|  |.|.|.|..
Mouse   322 VCLEITEDGGE------------SIEVPGSRILQHKDEFNADHPFIYIIRHNKTRNIIFFGKFCS 374

  Fly   373 P 373
            |
Mouse   375 P 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 116/379 (31%)
Serpinb5NP_001347782.1 maspin_like 4..375 CDD:239012 121/389 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.