DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpine2

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_033281.1 Gene:Serpine2 / 20720 MGIID:101780 Length:397 Species:Mus musculus


Alignment Length:378 Identity:126/378 - (33%)
Similarity:190/378 - (50%) Gaps:44/378 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL----------PDDKKEVAA 75
            |.|:: |.....|::.||..:...|.|..:||..||.:::..|::.          ..:|..|:.
Mouse    39 FNQII-KSRPHENVVVSPHGIASILGMLQLGADGKTKKQLSTVMRYNVNGVGKVLKKINKAIVSK 102

  Fly    76 KYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNN 140
            |.||:            :::||.:::...|::...:....||.|..|.:.::..||..||..:|.
Mouse   103 KNKDI------------VTVANAVFLRNGFKMEVPFAVRNKDVFQCEVQNVNFQDPASASESINF 155

  Fly   141 WVDNQTRGKIKDLVSSN--DMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEM- 202
            ||.|:|||.|.:|:|.|  |.:...|:::||:||||.|:.:|.|:.||||.|...|.||..|.| 
Mouse   156 WVKNETRGMIDNLLSPNLIDGALTRLVLVNAVYFKGLWKSRFQPESTKKRTFVAGDGKSYQVPML 220

  Fly   203 --MSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLP-DQVDGLSEL-----EKKIVGFKPKLS 259
              :|:|:|......:.|....|||||...|:||||.|| :....||.:     .|.|..:...:.
Mouse   221 AQLSVFRSGSTRTPNGLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHITTKTIDSWMNTMV 285

  Fly   260 KMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAFIEVNEEG 323
            ...:.|.||||.......|.:.|.|:||.:.||.| |:|..:..:.::||..::.||.|||:|:|
Mouse   286 PKRMQLVLPKFTAVAQTDLKEPLKALGITEMFEPSKANFTKITRSESLHVSHILQKAKIEVSEDG 350

  Fly   324 AEAAAA-TALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            .:|:|| ||:|..|.|.|.      |..|.||.:.||...|  |.|.|...||
Mouse   351 TKASAATTAILIARSSPPW------FIVDRPFLFSIRHNPTGAILFLGQVNKP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 124/373 (33%)
Serpine2NP_033281.1 serpinE2_GDN 21..395 CDD:381039 124/374 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.