DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina3g

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:369 Identity:114/369 - (30%)
Similarity:192/369 - (52%) Gaps:27/369 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR-----NVLKLP 67
            |...|.:..||...|:.|..:|...|::.||.|:..||::..:||::.|.:|:.     |:.:.|
Mouse    35 LTLVSSNTDFAFSLYRKLVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETP 99

  Fly    68 DDKKEVAAKY-KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDP 131
            :.......:| .||||:...:.:::|   .:.:::.|..|::..:.:..:..:.|||...|...|
Mouse   100 EPDIHQGFRYLLDLLSQPGNQVQIST---GSALFIEKHLQILAEFKEKARALYQAEAFTADFQQP 161

  Fly   132 NKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQK 196
            .||:.::|::|.|.|:||||.|:|....| |.::::|.|||||:|:..|:|..|.|..|.:.:::
Mouse   162 LKATKLINDYVSNHTQGKIKQLISGLKES-MLMVLVNYIYFKGKWKNPFDPNDTFKSEFYLDEKR 225

  Fly   197 SVPVEMMSL-FQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIV-------- 252
            ||.|.||.. :.:.....|.||...::||.|..::.:|.| |||| ..:.::|..:.        
Mouse   226 SVIVSMMKTGYLTTPYFRDEELSCTVVELKYTGNASAMFI-LPDQ-GRMQQVEASLQPETLRKWK 288

  Fly   253 -GFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAF 316
             ..||   :|...||||||.|.....|..:|..:||::.|...||...:....::.|.:|:|||.
Mouse   289 NSLKP---RMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLSAITGTKDLRVSQVVHKAV 350

  Fly   317 IEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRD 360
            ::|.|:|.||||||.:..|.........::.||  .||..:|.|
Mouse   351 LDVAEKGTEAAAATGMAGVGCCAVFDFLEIFFN--RPFLMIISD 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 112/363 (31%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 110/358 (31%)
RCL 357..382 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.