DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina3k

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_035588.2 Gene:Serpina3k / 20714 MGIID:98377 Length:418 Species:Mus musculus


Alignment Length:383 Identity:120/383 - (31%)
Similarity:202/383 - (52%) Gaps:28/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL---PDD 69
            |...||:..||...|:.||.:|...|::.||||:..||::..:||:.||.:|:...||.   ...
Mouse    46 LTLASVNTDFAFSLYKKLALKNQDKNIVFSPLSISAALALVSLGAKGKTMEEILEGLKFNLTETP 110

  Fly    70 KKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKA 134
            :.::...:.:||..|...|....:::.|.:::.|..|::..:::..:..:..||...|...|.:|
Mouse   111 EADIHQGFGNLLQSLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPTEA 175

  Fly   135 SSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVP 199
            .:::|::|.|||:|.||.|:|..|...: ::::|.|||||:|:..|:|:.|.:..|.:.:::||.
Mouse   176 KNLINDYVSNQTQGMIKKLISELDDGTL-MVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSVK 239

  Fly   200 VEMMSLFQSFRAAH--DSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPK-LSKM 261
            |.||.: :...|.|  |.||...::||.|..:: |.|:.||||    ..:::.....:|: |.|.
Mouse   240 VPMMKM-KLLTARHFRDEELSCSVLELKYTGNA-SALLILPDQ----GRMQQVEASLQPETLRKW 298

  Fly   262 DVT--------LRLPKFKIEFFAQLNK-VLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFI 317
            ..|        |.||||.|....:|.: ||..|||::.|.:.||...:.|...:.|.:|:|||.:
Mouse   299 RKTLFSSQIEELNLPKFSIASDYRLEEDVLPEMGIKEVFTEQADLSGITEAKKLSVSQVVHKAVL 363

  Fly   318 EVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVI--RDRETIYFQGHFVKP 373
            :|.|.|.||||||.::.......:|:  :.||  .||..||  ...::|.|......|
Mouse   364 DVAETGTEAAAATGVIGGIRKAVLPA--VCFN--RPFLIVIYHTSAQSILFMAKVNNP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 116/372 (31%)
Serpina3kNP_035588.2 SERPIN 57..417 CDD:214513 114/370 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.