DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb9c

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:373 Identity:113/373 - (30%)
Similarity:197/373 - (52%) Gaps:23/373 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLL 81
            ||.:..::|...|.:.|:..||:::..||:|..:|.:..|..::...:.| :...::...:..:|
Mouse    38 FAVNLLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAIGL-NTAIDIHQSFLWIL 101

  Fly    82 SKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVD-PNKASSIVNNWVDNQ 145
            :.|:...:..|..:|||::.....:.:|::.:.....:..|.|.:.... |.:|.:.:|.||...
Mouse   102 NILKKPTRKYTFRMANRLFAENTCEFLPTFKEPCLQFYHWEMEHLPFTKAPEEARNHINTWVCKN 166

  Fly   146 TRGKIKDLVSSNDM-SKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSF 209
            |:|||.:|:||..: |:..|:::||:||||:|.::|:.|.|:|..|:::..:..||:||.....|
Mouse   167 TKGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQFDIKSTRKMPFKINKDEERPVQMMFQEDMF 231

  Fly   210 RAAHDSELGAKIIELPYRNSSLSMLIFLPD------QVDGLSELEKKIVGFKPK-LSKMDVTLRL 267
            :.|:.:|:..:::.|||:...||:::.|||      :|:|....||.....||. |....|.:.|
Mouse   232 KLAYVNEVQVQVLVLPYKGKELSLVVLLPDDGVELSKVEGNLTFEKLSAWTKPDYLKTTKVLVFL 296

  Fly   268 PKFKIEFFAQLNKVLVAMGIQDAFE-KSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATA 331
            ||||:|.:..:..:...:|:.|.|: ..||..::.....:.|.|.|.|..:||||||.||.||||
Mouse   297 PKFKLEDYYDMESIFQDLGVGDIFQGGKADLSEMSPERGLCVSKFIQKCVVEVNEEGTEATAATA 361

  Fly   332 LLFVRYSMPMPSSQ----MVFNADHPFAYVIRDRET--IYFQGHFVKP 373
                  ...:.|::    ..|.|||||.:.||..:|  |.|.|.|..|
Mouse   362 ------DDTVCSAETHDGQTFCADHPFLFFIRHNKTNSILFCGRFSFP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 111/368 (30%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 112/371 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.