DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina1c

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_033271.1 Gene:Serpina1c / 20702 MGIID:891969 Length:413 Species:Mus musculus


Alignment Length:377 Identity:104/377 - (27%)
Similarity:189/377 - (50%) Gaps:22/377 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL---PDDK 70
            :||::. .||...|:.|..::..:|:..||:|:..|.:|..:|::..|..::...|:.   ...:
Mouse    44 IATNLG-DFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSE 107

  Fly    71 KEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS 135
            .::...::.||..|...:....||..|.::||...:||..:.:..|:.:.||..:::..:..:|.
Mouse   108 ADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAK 172

  Fly   136 SIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPV 200
            .::|::|:..|:|||.:.|...|...: ..:.|.|.|||:|:..|:|:.|::..|.|.:..:|.|
Mouse   173 KVINDFVEKGTQGKIAEAVKKLDQDTV-FALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKV 236

  Fly   201 EMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSE-----LEKKIVG-FKPKLS 259
            .||:|.......|.|.|.:.::.:.|..::.::.: |||  ||..:     |.|:::. |..|..
Mouse   237 PMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFL-LPD--DGKMQHLEQTLSKELISKFLLKRP 298

  Fly   260 KMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLV-ENSNVHVKKVIHKAFIEVNEEG 323
            :....:..|:..|.....|..::..:||...|...||...:. ||:.:.:.:.:|||.:.::|.|
Mouse   299 RRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTMDETG 363

  Fly   324 AEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            .||||||.||.|.||||     .:...||||.::|.:..|  ..|.|..|.|
Mouse   364 TEAAAATVLLAVPYSMP-----PIVRFDHPFLFIIFEEHTQSPLFVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 100/367 (27%)
Serpina1cNP_033271.1 SERPIN 53..410 CDD:214513 99/365 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.