DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina1a

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001239498.1 Gene:Serpina1a / 20700 MGIID:891971 Length:436 Species:Mus musculus


Alignment Length:379 Identity:103/379 - (27%)
Similarity:187/379 - (49%) Gaps:26/379 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL---PDDK 70
            :||::. .||...|:.|..::..:|:..||:|:..|.:|..:|::..|..::...|:.   ...:
Mouse    67 IATNLG-DFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSE 130

  Fly    71 KEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS 135
            .::...::.||..|...:....||..|.::||...:||..:.:..|:.:.||..:::..:..:|.
Mouse   131 ADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAK 195

  Fly   136 SIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPV 200
            .::|::|:..|:|||.:.|...|...: ..:.|.|.|||:|:..|:|:.|::..|.|.:..:|.|
Mouse   196 KVINDFVEKGTQGKIAEAVKKLDQDTV-FALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKV 259

  Fly   201 EMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDG-LSELEKKIVGFKPKLSKMDVT 264
            .||:|.......|.|.|.:.::.:.|..::.::.: |||  || :..||:.:  .|..:||..:.
Mouse   260 PMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFL-LPD--DGKMQHLEQTL--SKELISKFLLN 319

  Fly   265 LR-------LPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLV-ENSNVHVKKVIHKAFIEVNE 321
            .|       .|:..|.....|..::..:||...|...||...:. ||:.:.:.:.:|||.:.::|
Mouse   320 RRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDE 384

  Fly   322 EGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            .|.||||.|.|..|..|||     .:...||||.::|.:..|  ..|.|..|.|
Mouse   385 TGTEAAAVTVLQMVPMSMP-----PILRFDHPFLFIIFEEHTQSPIFLGKVVDP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 99/369 (27%)
Serpina1aNP_001239498.1 SERPIN 76..433 CDD:214513 98/367 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.