DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb3a

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_033152.3 Gene:Serpinb3a / 20248 MGIID:3573933 Length:387 Species:Mus musculus


Alignment Length:392 Identity:130/392 - (33%)
Similarity:216/392 - (55%) Gaps:34/392 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPD----- 68
            |....:.:|..:.|:.|.:.:  ||:..||:|:..||:|..:||:..|.:::..||:..:     
Mouse     3 LFAEATTKFTLELYRQLRESD--NNIFYSPISMMTALAMLQLGAKGNTEKQIEKVLQFNETTKKT 65

  Fly    69 --------DKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEA 125
                    |::.|..:::.|:::|........|..||.||..|.|..|.::.:.:|:.:.|..|:
Mouse    66 TEKSAHCHDEENVHEQFQKLMTQLNKSNDAYDLKAANSIYGAKGFPFVQTFLEDIKEYYQANVES 130

  Fly   126 IDIVD-PNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKKR 188
            :|... ..::...:|:||::||.||||||..:..:::..::|| ||:||||||.:||:.|.|.:.
Mouse   131 LDFEHAAEESEKKINSWVESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDEKHTTEE 195

  Fly   189 NFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVG 253
            .|.::...|.||:||.....|......::.|||:|:||:...|||::.||.:::||.:||:::..
Mouse   196 KFWLNKNTSKPVQMMKQNIEFNFMFLEDVQAKIVEIPYKGKELSMIVLLPVEINGLKQLEEQLTA 260

  Fly   254 FK----PKLSKMDVT---LRLPKFKIEFFAQLNKVLVAMGIQDAFE-KSADFKDLVENSNVHVKK 310
            .|    .:...|.:|   |.||:||::....|...|..||:.|||: :.|||..:.....:.|.|
Mouse   261 DKLLEWTRAENMHMTELYLSLPRFKVDEKYDLPIPLEHMGMVDAFDPQKADFSGMSSTQGLVVSK 325

  Fly   311 VIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMV--FNADHPFAYVIRDRET--IYFQGHFV 371
            |:||:|:||||||.||||||.:     .:.:.|:|:.  |..||||.:.|..|:|  |.|.|...
Mouse   326 VLHKSFVEVNEEGTEAAAATGV-----EVSLTSAQIAEDFCCDHPFLFFIIHRKTNSILFFGRIS 385

  Fly   372 KP 373
            .|
Mouse   386 SP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 128/382 (34%)
Serpinb3aNP_033152.3 SERPIN 5..387 CDD:294093 128/388 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.