DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinf2

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:383 Identity:112/383 - (29%)
Similarity:185/383 - (48%) Gaps:59/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLL 81
            |..|.:.|:|:.:.::||:.|||||.:|||...:||:.:|...:..||.:     ...:....||
Mouse    89 FTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHM-----NTGSCLPHLL 148

  Fly    82 SKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKAS-------SIVN 139
            |.........|:.||.|||:.|.|.        :||.|:.::|.:....|.|.:       :.:|
Mouse   149 SHFYQNLGPGTIRLAARIYLQKGFP--------IKDDFLEQSERLFGAKPVKLTGKQEEDLANIN 205

  Fly   140 NWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMS 204
            .||...|.|||:|.:|....|.: |::||||:|.|.|..||:|.||:|..|.:.::.:|.|:||.
Mouse   206 QWVKEATEGKIEDFLSELPDSTV-LLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMH 269

  Fly   205 LFQ-----------SFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVD-GLSELEKKIVG---F 254
            ...           ..:.||          .|::| ::|.::.:|...: .:||:...:..   :
Mouse   270 AVSYPLRWFLLEQPEIQVAH----------FPFKN-NMSFVVVMPTYFEWNVSEVLANLTWDTLY 323

  Fly   255 KPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEV 319
            .|.|.:....:.|||..::....|...|..:|:|:.|: ..|.:.:.| .|:.|..|.|::.:|:
Mouse   324 HPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQ-GPDLRGISE-QNLVVSSVQHQSTMEL 386

  Fly   320 NEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETI---YFQGHFVKPN 374
            :|.|.||||||::...|.|:   ||   |..:.||.:.|.: :||   .|.|....||
Mouse   387 SEAGVEAAAATSVAMNRMSL---SS---FTVNRPFLFFIME-DTIGVPLFVGSVRNPN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 110/377 (29%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 110/377 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.