DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpine1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus


Alignment Length:399 Identity:116/399 - (29%)
Similarity:191/399 - (47%) Gaps:35/399 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CLLL-------------LATSVSCRFADDF----YQLLAKENAANNLISSPLSVEIALSMAYMGA 52
            ||:|             |..|.:...|.||    :|.:.:.:...|::.||..|...|:|..|..
Mouse     9 CLILGLVLVSGKGFTLPLRESHTAHQATDFGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTT 73

  Fly    53 RAKTAQEMRNVLKLPDDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKD 117
            ..||.:::::.:....::|..|...:.|..:|.|......:|.|:.|:|.:..:||..:......
Mouse    74 AGKTRRQIQDAMGFKVNEKGTAHALRQLSKELMGPWNKNEISTADAIFVQRDLELVQGFMPHFFK 138

  Fly   118 SFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKM-ELIVLNAIYFKGQWEYKFN 181
            .|....:.:|..:..:|..|:|:||:..|:|.|.||::...:.:: .|:::||:||.|||:..|.
Mouse   139 LFQTMVKQVDFSEVERARFIINDWVERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQWKTPFL 203

  Fly   182 PKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAH---DSELGAKIIELPYRNSSLSMLIFLPDQVD- 242
            ...|.:|.|..||..:|.|.||:....|....   ...|...::||||:..:|||.|..|.:.| 
Mouse   204 EASTHQRLFHKSDGSTVSVPMMAQSNKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDV 268

  Fly   243 GLSEL-----EKKIVGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLV 301
            .||.|     .:.|..:|..::::...|.||||.:|....|...|..:|:.|.|..: |||..|.
Mouse   269 HLSALTNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFSATLADFTSLS 333

  Fly   302 ENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDR--ETI 364
            :...:.|.:.:.|..|||||.|..|:::||.:.   |..|..::||.  |..|.:|:|..  |||
Mouse   334 DQEQLSVAQALQKVRIEVNESGTVASSSTAFVI---SARMAPTEMVI--DRSFLFVVRHNPTETI 393

  Fly   365 YFQGHFVKP 373
            .|.|..::|
Mouse   394 LFMGQVMEP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 110/372 (30%)
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 111/377 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.