DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and srp-1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_503315.1 Gene:srp-1 / 178585 WormBaseID:WBGene00005642 Length:366 Species:Caenorhabditis elegans


Alignment Length:342 Identity:90/342 - (26%)
Similarity:177/342 - (51%) Gaps:23/342 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ISSPLSVEIALSMAYMGARAKTAQEMRN-VLKLPDDKKEVAAKYKDLLSKL--EGREKVATLSLA 96
            :.||:|:.::|::.::||:..|..::|| |:....|::.:  ::...::||  .....|.|| :|
 Worm    32 VFSPVSILLSLALVHLGAKGHTRHDIRNSVVNGSTDEQFI--EHFSFINKLLNSSVNDVETL-IA 93

  Fly    97 NRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSK 161
            ||::|:.:..:..::...:::.:.||...||.....:|:.|:|.::...|:|||.|::..:::..
 Worm    94 NRLFVSPEQAIRKAFTDELREHYNAETATIDFKKSQEAAKIMNQFISESTKGKIPDMIKPDNLKD 158

  Fly   162 MELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPY 226
            ::.|::|||:|:|.|..||..  ..:.||.:|..::..|.|:...:.:....|.|.  ::|.:|:
 Worm   159 VDAILINAIFFQGDWRRKFGE--PAESNFSISATENRLVPMLRETRDYFYNKDDEW--QVIGIPF 219

  Fly   227 RNSSLSMLIFLPDQVDGLSELEKKIVGFK-----PKLSKMDVTLRLPKFKIEFFAQLNKVLVAMG 286
            ::.|....||||.:...|:|..|.:...|     ..:.:..:.|..||||:::...|...|...|
 Worm   220 KDKSAWFAIFLPTRRFALAENLKSLNAAKFHNLINNVYQEYIFLTFPKFKMDYKINLKTALAKFG 284

  Fly   287 IQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAAT--ALLFVRYSMPMPSSQMVFN 349
            :.:.|.:.||...:  ...:.:....|:|.|||::.|..|||||  .:.|...|...|   :...
 Worm   285 LAELFTEQADLSGI--GPGLQLASATHQALIEVDQVGTRAAAATEAKIFFTSASSDEP---LHIR 344

  Fly   350 ADHPFAY-VIRDRETIY 365
            .||||.: :|:|...::
 Worm   345 VDHPFLFAIIKDNSPLF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 90/342 (26%)
srp-1NP_503315.1 serpinL_nematode 11..365 CDD:381047 90/342 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H76659
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.