DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and SERPINA12

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:359 Identity:94/359 - (26%)
Similarity:187/359 - (52%) Gaps:20/359 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMR---NVLKLPDDKKEVAAKYKDLLSKLEG 86
            ||..|...|:..||||:..|.||..:||:..|..|::   |..|:|:  |::...:..::.:|..
Human    63 LAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPE--KDLHEGFHYIIHELTQ 125

  Fly    87 REKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWVDNQTRGKIK 151
            :.:...||:.|.::::::.|....:.:..|:.:.||....:..:...|...:|:::..:|.|||.
Human   126 KTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKIN 190

  Fly   152 DLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSE 216
            :|:.:.|...: :::.|.|:|:.:|:::|:|.:||:.:|.:....||.|.||.....::..:|.:
Human   191 NLIENIDPGTV-MLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDK 254

  Fly   217 LGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKI-----VGFKPKLSKMDVTLRLPKFKIEFFA 276
            |...|:|:||: .:::.:..|||: ..|..|||.:     ..:|..||:..|.:.:|:..:....
Human   255 LSCTILEIPYQ-KNITAIFILPDE-GKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTF 317

  Fly   277 QLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPM 341
            .|.|.|..:|:...||:..|...:..:.::.|.:.:|||.::::|.|.|.||.|.    ..::||
Human   318 DLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTG----AQTLPM 378

  Fly   342 PSSQMVFNADHPFAYVIRDRE--TIYFQGHFVKP 373
             .:.:|...|.|:..:|...:  ::.|.|..|.|
Human   379 -ETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 92/354 (26%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 93/357 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.