DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpina6

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:398 Identity:107/398 - (26%)
Similarity:192/398 - (48%) Gaps:56/398 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HLCLLLLATS---------------------VSCRFADDFYQLLAKENAANNLISSPLSVEIALS 46
            :.||..|.||                     .:..||.:.|:.|...|:..|.:.||:|:.:||:
Mouse     6 YTCLFWLCTSGLWTTQAVTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALA 70

  Fly    47 MAYMGARAKTAQEMR----NVLKLPDDKKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQL 107
            |..:..|..| |.:.    |:.|:  .:.|:...::.|.|.|:..:....:::.|.:::.:..:|
Mouse    71 MLSLSTRGST-QYLENLGFNMSKM--SEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKL 132

  Fly   108 VPSYNQMVKDSFMA------EAEAIDI--VDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKMEL 164
                    ||||:|      |:||:.|  .|..||...:||.|.|:|:|||:.:||..| |...|
Mouse   133 --------KDSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVVSDLD-SSATL 188

  Fly   165 IVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNS 229
            |::|.|:.||.|:..|:|:.|::.:|.|::..:|.|.||....:.....||.:..:::::.|..:
Mouse   189 ILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGN 253

  Fly   230 SLSMLIFLPD--QVDG-LSELEKKIVGFKPKLS-KMDVTLRLPKFKIEFFAQLNKVLVAMGIQDA 290
            ..:.:| |||  |:|. ::.|.:..:....||. ...:.|.:|||.:.....|..||..:||:|.
Mouse   254 GTTFII-LPDQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDL 317

  Fly   291 FEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFA 355
            |...:||.|..:::.:.: .|:|||.::::|.....||...     ..:.:||.......:.||.
Mouse   318 FTNQSDFADTTKDTPLTL-TVLHKAMLQLDEGNVLPAATNG-----PPVHLPSESFTLKYNRPFI 376

  Fly   356 YVIRDRET 363
            ::..|:.|
Mouse   377 FLAFDKYT 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 102/366 (28%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 100/361 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.