DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and Serpinb7

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_569088.1 Gene:Serpinb7 / 117092 RGDID:71063 Length:380 Species:Rattus norvegicus


Alignment Length:377 Identity:117/377 - (31%)
Similarity:187/377 - (49%) Gaps:27/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL-------PDD 69
            :.:..|..|.::.:.......|:..|.||:..|||:..:|||...|:::...|..       ...
  Rat     6 AANAEFGFDLFREMDSSQGNGNVFFSSLSIFTALSLIRLGARGDCARQIDKALHFISPSRQGNSS 70

  Fly    70 KKEVAAKY--KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIV-DP 131
            ..::..:|  |.:|:.:....|...||:||.::..|.|....||.:..::.:.|:.|.:|.. |.
  Rat    71 NSQLGLQYQLKRVLADINSSHKDYELSIANGVFAEKVFDFHKSYMECAENLYNAKVERVDFTNDI 135

  Fly   132 NKASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFKGQWEYKFNPKLTKKRNFRVSDQ 195
            .:....:|.|::|:|.||||.::..:.:|...::|| ||:||||:|:..|....|...:||....
  Rat   136 QETRFKINKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTKSDTLSCHFRSPSG 200

  Fly   196 KSVPVEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFK----- 255
            ....|.||...:.|..:...|...:|:||.| :..:||.|.||:  |.|||:|.|: .|:     
  Rat   201 PGKAVNMMHQERRFNLSTIQEPPMQILELQY-HGGISMYIMLPE--DDLSEIESKL-SFQNLMDW 261

  Fly   256 ---PKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAF-EKSADFKDLVENSNVHVKKVIHKAF 316
               .|:....|.:.||:||||...::...|.::|::|.| |..||...:.....::|.|::||:.
  Rat   262 TNSRKMKSQYVNVFLPQFKIEKDYEMRSHLKSVGLEDIFVESRADLSGIASGGRLYVSKLMHKSL 326

  Fly   317 IEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRETIYFQG 368
            |||:|||.||.|||....|...:|   ...||.||.||.:|||....|.|.|
  Rat   327 IEVSEEGTEATAATESNIVEKLLP---ESTVFRADRPFLFVIRKNGIILFTG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 117/375 (31%)
Serpinb7NP_569088.1 SERPIN 4..380 CDD:294093 117/377 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.