DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and LOC100909605

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:387 Identity:116/387 - (29%)
Similarity:193/387 - (49%) Gaps:33/387 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ATSVSCR--FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL---PDD 69
            :|..||.  ||...|:.|..:|...|::.|..|:..||.:..:||:..|.:|:...||.   ...
  Rat    35 STLSSCNTDFAFSLYKELVLKNPDKNIVFSSFSISTALVLLSLGAKNNTLKEILEGLKFNLTETP 99

  Fly    70 KKEVAAKYKDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKA 134
            :.|:...|:.||.:|........:|..:.:::.|..|::..:.:..:..:.|||.:.|...|::|
  Rat   100 EAEIHQGYEHLLQRLNLPGDQVQISTGSALFIKKHLQILAEFQEKARALYQAEAFSTDFQQPHEA 164

  Fly   135 SSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVP 199
            ..::|::|..||:||||:|:|..| .|..::::|.|||||:|:..|:|..|.:..|.:.::|||.
  Rat   165 KKLINDYVRKQTQGKIKELISVLD-KKTSMVLVNYIYFKGKWKMPFDPHDTFQSEFYLDEKKSVK 228

  Fly   200 VEMMSLFQ----SFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELEKKIVGFKPKL-- 258
            |.||.:.:    .||   |.||...::||.|..:: |.|..||||    ..:::.....:|:.  
  Rat   229 VPMMKIEKLTTPYFR---DEELSCSVLELKYTGNA-SALFILPDQ----GRMQQVEASLQPETLR 285

  Fly   259 --------SKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKA 315
                    .::| .||:|||.|....:|..:|..:||::.|.:.||...:....::.|.:|:|||
  Rat   286 RWKDTLRPRRID-ELRMPKFSISTDMRLGDILPELGIREVFSQQADLSRITGAKDLSVSQVVHKA 349

  Fly   316 FIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKPNE 375
            .::|.|.|.||||||.:..:..........|.||  .||..:|.|..|  ..|......|.|
  Rat   350 VLDVTETGTEAAAATGVKIIPMCAKFYYVTMYFN--RPFLMIISDTNTHIALFMAKVTNPKE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 113/376 (30%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 111/374 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.