DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serpinb10

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_031760330.1 Gene:serpinb10 / 100497689 XenbaseID:XB-GENE-5769609 Length:374 Species:Xenopus tropicalis


Alignment Length:372 Identity:117/372 - (31%)
Similarity:197/372 - (52%) Gaps:22/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAAKYKDLL 81
            |..|..:.::|..|..|::.|.:|:.|:|:|.|:||...||.:|...|.. |:.::|.|:::.||
 Frog    10 FTIDVLREISKTAAGQNVVFSSMSIMISLAMVYLGAHGNTAADMGKALHF-DEVEDVHAQFRVLL 73

  Fly    82 SKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDI-VDPNKASSIVNNWVDNQ 145
            .:|.......||:..|:::..||:..:|::.:.:...:.|..|.:|. .:|....|.:|.|:..:
 Frog    74 KELMKNGNDYTLTTVNKLFGEKKYYFLPTFLKAINAFYGAPLEKVDFSSNPEATRSYINAWIQEK 138

  Fly   146 TRGKIKDLVSSNDMS-KMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSF 209
            |:|||::|:..|.:| ...|:|.|.:||...|..:|:...|.|..|.:...:.:.|.||:...:|
 Frog   139 TKGKIQNLLPENSISPNTVLMVANTLYFLANWTTQFSEHATSKAPFTLITNEQIKVNMMATMNTF 203

  Fly   210 RAAHDSELGAKIIELPYRNS-SLSMLIFLPDQVDGLSELEKKIVGFKPKLSKMD---------VT 264
            ........|..::||||.:: .|||:|.|||....|::::::|  ....|||..         :.
 Frog   204 NMKRIKNPGMSVLELPYGDTKDLSMVIMLPDNSTVLTKVDREI--SYENLSKWTRSENMSSNYLA 266

  Fly   265 LRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAA 328
            :.||:|::|....|.|||.::|:..||.:| |:|..:.:...::|..|.||.||||||:|.|||:
 Frog   267 VYLPRFRMEKSFSLKKVLSSLGMSSAFSQSRANFSGMGKQKQLYVSDVHHKTFIEVNEKGTEAAS 331

  Fly   329 ATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            ||..:....|:    :...|.||.||.:.||..:|  |...|.|..|
 Frog   332 ATGSVMSIRSL----ANEEFKADRPFHFFIRHNKTNCILLYGKFYSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 115/367 (31%)
serpinb10XP_031760330.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm9399
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.