DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serpina10

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_012824917.1 Gene:serpina10 / 100487295 XenbaseID:XB-GENE-983018 Length:437 Species:Xenopus tropicalis


Alignment Length:378 Identity:105/378 - (27%)
Similarity:191/378 - (50%) Gaps:24/378 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKL-PDDKKEVA 74
            :.:|..|..:.|:.:|.:: .||:..||.||.:.||...:|.|..|..::.:.|.. |...:|..
 Frog    70 SQMSSDFGFNLYRKIANKH-DNNIFFSPFSVSLGLSSLLLGTRGNTYDQLLHGLNYNPFKDQENP 133

  Fly    75 AKYKDLLSKLEGREKVA-----TLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKA 134
            ....:||..:  :||:|     .|::.:..::::.|.:...:..:.|..|..|.|.||. ..:||
 Frog   134 YLLPELLKTI--KEKIAKNEELVLNIGSLSFLHETFSMKDEFVNLTKKYFDMEYELIDF-HSSKA 195

  Fly   135 SSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVP 199
            .:.:|.:|:..|:|.|.:.....| .:.:|::|:.|:|||:|:|.|||.||:..:|.:....||.
 Frog   196 KNEINAYVEKLTKGLISNFYDFID-PQTKLLLLDYIFFKGKWQYPFNPALTEVDSFFIDKYNSVT 259

  Fly   200 VEMMSLFQSFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELE----KKIV-GFKPKLS 259
            |.||.......:..|.:|...:.:||||.:: .|||..|::......||    |::: .::.|:.
 Frog   260 VPMMYKTDKVASVFDKDLSCTVFKLPYRGNA-HMLIIKPEKEGDFGILEDHLTKELINSWQAKMQ 323

  Fly   260 KMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGA 324
            .....:..||||::...:|...|..:||::.|...|:..||.|..|:.:.::..:|.|||:|.|.
 Frog   324 SRKTDIFFPKFKLDQKYKLKSSLNELGIKELFTGKANLTDLTEERNLMLTEITQQAMIEVDERGT 388

  Fly   325 EAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDR--ETIYFQGHFVKPNE 375
            ||||......:.||:|     :....:.||.::|.:.  :::.|.|..:.|.:
 Frog   389 EAAAVAGAEIIAYSLP-----LTIRVNRPFLFMIFEEAYQSLLFLGRVMDPTK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 104/368 (28%)
serpina10XP_012824917.1 serpinA10_PZI 58..436 CDD:381011 105/376 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.