DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serpine1

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001108031.1 Gene:serpine1 / 100136840 ZFINID:ZDB-GENE-070912-60 Length:384 Species:Danio rerio


Alignment Length:388 Identity:112/388 - (28%)
Similarity:193/388 - (49%) Gaps:38/388 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCLLLLATSVSCRFADDFYQLLAK--ENAAN-NLISSPLSVEIALSMAYMGARAKTAQEMRNVLK 65
            ||...|...:..:..|...|:.|:  ::|.: ||..||..:...|.||.|||...|       ||
Zfish    12 LCASSLCNLIQDKQTDFGLQVFAEAVQSAPDRNLALSPYGIASVLGMAQMGAYGAT-------LK 69

  Fly    66 LPDDKKEVAAKYKDL--LSKLEGREKVAT--LSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAI 126
            |...|...:.:.:.:  |.:|..|:..:.  :.:|:.:.|::|..|...:.:.:..:|.:....|
Zfish    70 LLASKMGYSLQERGMPKLQRLLQRDLASEDGVEVASGVMVDRKIILEKVFRRSLSKAFQSVPHQI 134

  Fly   127 DIVDPNKASSIVNNWVDNQTRGKIKDLVSSNDMSKM-ELIVLNAIYFKGQWEYKFNPKLTKKRNF 190
            |...|..|..::|:|..:.|.|.|.:.:.|..:|:: .|:.|||::|.|.|:..|:|:.|:::.|
Zfish   135 DFSQPEMARQVINSWTSDHTDGMISEFLPSGVLSELTRLVFLNALHFHGVWKTPFDPRNTREQLF 199

  Fly   191 RVSDQKSVPVEMMSLFQSFRAAHDSELGAK------IIELPYRNSSLSMLIFLPDQVD-GLSELE 248
            ...:..:|.|.||:..|.|   :..|..:|      :||:||...|:|||:..|.:.| .||.|.
Zfish   200 HTVNGSAVSVPMMTTTQKF---NYGEFVSKDGVDYDVIEMPYEGESISMLLVTPFEKDVPLSALN 261

  Fly   249 K-----KIVGFKPKLSKMDVTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKS-ADFKDLVENSNVH 307
            |     :|..::.::.|:...|.:|:|.::....|...|..||:.|.|.:| |||..:.....:.
Zfish   262 KELSSSRIHQWRQEMRKISKQLSIPRFSMDTEIDLKSTLSRMGLGDIFSQSRADFSRITTEEPLC 326

  Fly   308 VKKVIHKAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQG 368
            |.||:.:..:||||||.:.::|||.  |.||. |...::..  |.||.::|:.:.|  :.|.|
Zfish   327 VSKVLQRVKLEVNEEGTKGSSATAA--VIYSR-MAVEEITL--DRPFFFLIQHKPTGALLFSG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 109/378 (29%)
serpine1NP_001108031.1 SERPIN 26..384 CDD:294093 108/372 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.