DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28F and serpina10b

DIOPT Version :9

Sequence 1:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:368 Identity:104/368 - (28%)
Similarity:190/368 - (51%) Gaps:24/368 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLP----DDKKEVAAKY 77
            ||.:.|:.::..: ..|::.|||||....|...:.|:..|..|:...|.|.    .|.:.|...:
Zfish    38 FAINLYRKISSLH-DRNVVFSPLSVSTCFSALLLAAQGSTRTEILKGLNLEALDGGDSRRVPELF 101

  Fly    78 KDLLSKLEGREKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNKASSIVNNWV 142
            :.|...:..:.:..|     .:::::.|.|..:::|.::..|.||...:|...|....|::|.:|
Zfish   102 QQLHQNISLQMEQGT-----ALFLDQHFHLQTNFSQQIQRFFNAEVLRVDFSKPAVCRSLINEFV 161

  Fly   143 DNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQ 207
            ..:|..|:.:::.|.: ...::::||.|::||.||..|||..|:|..|.|.....|.|.||.|.:
Zfish   162 SRKTGRKVLEMLESVE-PLTQMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKYNIVQVPMMMLEE 225

  Fly   208 SFRAAHDSELGAKIIELPYRNSSLSMLIFLPDQVDGLSELE-----KKIVGFKPKLSKMDVTLRL 267
            .|....|.:|.|:::.||||..: ||||.||......:.:|     :::.|:...:.:|.:.:.|
Zfish   226 KFSVVEDRDLRARVLRLPYRGGA-SMLILLPSADADYTAIEDEISAERLHGWIKNMRRMKMEVHL 289

  Fly   268 PKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATAL 332
            |:|:::....::::|..:||...|:.|||...|..::::.|.:|:|||.|||.|:|..||::|::
Zfish   290 PRFRMDQSYHMHELLPQLGISSVFQDSADLTGLSRDAHLKVSQVLHKAVIEVYEQGTSAASSTSV 354

  Fly   333 LFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373
            ....||:|     ..|..:.||.:.:...||  :.|.|..:.|
Zfish   355 GITAYSLP-----DTFIINRPFFFFLYHEETASLLFMGRVIDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 103/363 (28%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 103/366 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.