DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and Serpinb6c

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:371 Identity:123/371 - (33%)
Similarity:202/371 - (54%) Gaps:20/371 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL----PDDKKEVAAKF 77
            |..:|.::|. |:..||:..||:|:..||.:..:||:|.||.::...|.|    ..:..:|...|
Mouse    12 FALNLLKILG-EDRSKNVFLSPISISSALVMVLLGAKGTTAIQITQALSLGKCSSSEDGDVHQGF 75

  Fly    78 KDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANN-PKITASIVNKW 141
            :.|||::....:...|..|||::....|.::..:.......::||.|.:.... .:.:...:|.|
Mouse    76 QLLLSEVNKTGTQYSLKAANRLFGEKTFDILASFKDSCHKFYEAEMEELDFKGATEQSRQHINTW 140

  Fly   142 VDTQTSGKIRDLVMPSDV-ANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMMSL 204
            |..:|..||::|:.|..: :|..|:::||:||||:|:|:||.|.|:. .|.:|..:..|||||..
Mouse   141 VAKKTEDKIKELLSPGTIHSNTPLILVNAVYFKGKWEKQFNKEDTREMPFKVSKNEEKPVQMMFQ 205

  Fly   205 VRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEK-----KMVGFT--PKLININV 262
            ...|.::|..|:...::.|||..:.|:|:|.|||:...|..:||     |.:.:|  .::....|
Mouse   206 KSTFKMTYVEEISTKILLLPYVGNELNMIIMLPDEHVELSTVEKEITHEKFIEWTRLDRMKGEKV 270

  Fly   263 HLRLPKFKIEFSARLEQVLIAMGIQDAFKTS-ADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAA 326
            .:.||.||:|.:..::.||..:|:.|||:.. |||:.:.:..|..:..|:||:.:|||||||||.
Mouse   271 EVFLPWFKLEENYDMKDVLCKLGMTDAFEEGRADFSGISSKQGLFLSNVIHKSVVEVNEEGSEAT 335

  Fly   327 AATAVVFRYKSIRSPPMDFNVNHPFAYVIR--DAENIYFQGHFVNP 370
            |||.:|.:..| ||.|. |.||.||.:.|:  ....|.|.|...:|
Mouse   336 AATTIVLKGSS-RSTPC-FCVNRPFIFFIQHIKTNEILFLGRLSSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 122/369 (33%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 122/369 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44055
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.