DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINB7

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:375 Identity:100/375 - (26%)
Similarity:192/375 - (51%) Gaps:26/375 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVSCRFTDDLYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKL---------P 67
            :.:..|..:|::.:.....:.|:..|.||:..||:|..:||:..:..::..:|.:         .
Human     6 AANAEFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSS 70

  Fly    68 DDKKEVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAIS-ANNP 131
            :.:..:.::.|.:.|.:........||:.|.::....:....:|.:..:..:.|:.|.:. .|:.
Human    71 NSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHL 135

  Fly   132 KITASIVNKWVDTQTSGKIRDLVMPSDV-ANLVLVILNAIYFKGQWQKKFNTEQTKSDFHISDQK 195
            :.|...:||||:.:|.|||::::....: ::.|:|::||:||||:||..|...:| .:.|....|
Human   136 EDTRRNINKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSET-INCHFKSPK 199

  Fly   196 --SVPVQMMSLVRPFGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKK------MVG 252
              ...|.||...|.|.:|...:....::||.| |..::|.:.||:  :.|.|:|.|      |..
Human   200 CSGKAVAMMHQERKFNLSVIEDPSMKILELRY-NGGINMYVLLPE--NDLSEIENKLTFQNLMEW 261

  Fly   253 FTP-KLININVHLRLPKFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHKAF 315
            ..| ::.:..|.:..|:||||.:..::|.|.|:|::|.| ::.||.:.:.:....::..::||::
Human   262 TNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSY 326

  Fly   316 LEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHPFAYVIRDAENIYFQG 365
            :||.|||:||.|||......|.:....: |..:|||.:|||..:.|.|.|
Human   327 IEVTEEGTEATAATGSNIVEKQLPQSTL-FRADHPFLFVIRKDDIILFSG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 100/373 (27%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 100/375 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.