DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and SERPINH1

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:367 Identity:94/367 - (25%)
Similarity:177/367 - (48%) Gaps:26/367 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYQLLAKENADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVL---KLPDDKKEVAAKFKDLLS 82
            |||.:||:.|.:|::.||:.|..:|.|..:|.:..||.:.:.||   :|.|:  ||.|...:||.
Human    54 LYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDE--EVHAGLGELLR 116

  Fly    83 KLEGRESVAIL-SLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAISANNPKITASIVNKWVDTQT 146
            .|....:..:. .|.:|:|..:......::.:..|..:..|...|:..:.:.....:|:|....|
Human   117 SLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQTT 181

  Fly   147 SGKIRDL---VMPSDVANLVLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMMSLVRP 207
            .||:.::   |..:|.|.||    ||::||..|.:||:.:...: .|.::...:|.|.||.....
Human   182 DGKLPEVTKDVERTDGALLV----NAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVMMMHRTGL 242

  Fly   208 FGVSYDRELGANVIELPYRNSNLSMVIFLPDKVDGLPELEKKMVG-----FTPKLININVHLRLP 267
            :....|.:....::|:|..:...|::|.:|..|:.|..|||.:..     :..|:....|.:.||
Human   243 YNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAISLP 307

  Fly   268 KFKIEFSARLEQVLIAMGIQDAF-KTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAV 331
            |..:|.:..|::.|..:|:.:|. |..||.:.:......::..|.|....|::.:|:   .....
Human   308 KGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGN---PFDQD 369

  Fly   332 VFRYKSIRSPPMDFNVNHPFAYVIRDAE--NIYFQGHFVNPE 371
            ::..:.:|||.: |..:|||.:::||.:  ::.|.|..|.|:
Human   370 IYGREELRSPKL-FYADHPFIFLVRDTQSGSLLFIGRLVRPK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 93/364 (26%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 94/367 (26%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.