DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and AT1G64010

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001320592.1 Gene:AT1G64010 / 842704 AraportID:AT1G64010 Length:199 Species:Arabidopsis thaliana


Alignment Length:217 Identity:78/217 - (35%)
Similarity:111/217 - (51%) Gaps:38/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 IYFKGQWQKKFNTEQTKS-DFHISDQKSVPVQMMSLVR-PFGVSYDRELGANVIELPYR-----N 227
            :||||.|::||:...||. |||:.:..||.|.:||..: .:..:||   |..|::||:|     :
plant     1 MYFKGAWEEKFHKSMTKDRDFHLINGTSVSVSLMSSYKDQYIEAYD---GFKVLKLPFRQGNDTS 62

  Fly   228 SNLSMVIFLPDKVDGLPELEKKM---VGFTPKLI---NINV-HLRLPKFKIEFSARLEQVLIAMG 285
            .|.||..:|||:.|||..|.:||   |||....|   .:.| ...:|||||||            
plant    63 RNFSMHFYLPDEKDGLDNLVEKMASSVGFLDSHIPSQKVKVGEFGIPKFKIEF------------ 115

  Fly   286 IQDAFKTSADFNDLVANSGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPMDFNVNHP 350
               .|..|..||.|    |.....:..||.:|::|||:||.||||||..:.......:||..:||
plant   116 ---GFSASRAFNRL----GLDEMALYQKACVEIDEEGAEAIAATAVVGGFGCAFVKRIDFVADHP 173

  Fly   351 FAYVIRDAE--NIYFQGHFVNP 370
            |.::||:.:  .:.|.|...:|
plant   174 FLFMIREDKTGTVLFVGQIFDP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 77/215 (36%)
AT1G64010NP_001320592.1 serpin <1..195 CDD:393296 77/215 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.