DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn38F and AT3G45220

DIOPT Version :9

Sequence 1:NP_524956.2 Gene:Spn38F / 49806 FlyBaseID:FBgn0028986 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:401 Identity:110/401 - (27%)
Similarity:187/401 - (46%) Gaps:68/401 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DLYQLLAKE------NADKNLITSPLSVEIALSLAYMGARGKTAQEMRDVLKLPDD-------KK 71
            |:..||||.      |. .||:.||:|:.:.|.|...|:...|.:::...:.||..       .|
plant    12 DVMVLLAKHVIPTVANG-SNLVFSPMSINVLLCLIAAGSNCVTKEQILSFIMLPSSDYLNAVLAK 75

  Fly    72 EVAAKFKDLLSKLEGRESVAILSLANRIYVNNKFKLVPEYNQMVKDSFKAEAEAIS-ANNPKITA 135
            .|:....|.:.:     |...||.|..::::......|.:..::::|:.|....:. |..|....
plant    76 TVSVALNDGMER-----SDLHLSTAYGVWIDKSLSFKPSFKDLLENSYNATCNQVDFATKPAEVI 135

  Fly   136 SIVNKWVDTQTSGKIRDLVMPSDVANL---VLVILNAIYFKGQWQKKFNTEQTKS-DFHISDQKS 196
            :.||.|.:..|:|.|::::....:..:   :|::.||:||||.|.|||:.:.||| |||:.|...
plant   136 NEVNAWAEVHTNGLIKEILSDDSIKTIRESMLILANAVYFKGAWSKKFDAKLTKSYDFHLLDGTM 200

  Fly   197 VPVQMMSLVRPFGVSYDREL-----GANVIELPY--RNSNLSMVIFLPDKVDGLPELEKKMVGFT 254
            |.|       ||..:|.::.     |..|:.|||  .....:|.|:||:..||||.|.:: :...
plant   201 VKV-------PFMTNYKKQYLEYYDGFKVLRLPYVEDQRQFAMYIYLPNDRDGLPTLLEE-ISSK 257

  Fly   255 PKLININV--------HLRLPKFKIEFSARLEQVLIAMGIQDAFKTSADFNDLVAN--------- 302
            |:.::.::        ..::||||..|..:...||..||:...| |.....::|.:         
plant   258 PRFLDNHIPRQRILTEAFKIPKFKFSFEFKASDVLKEMGLTLPF-THGSLTEMVESPSIPENLCV 321

  Fly   303 -SGAHVGGVVHKAFLEVNEEGSEAAAATAVVFRYKSIRSPPM---DFNVNHPFAYVIRDAEN--I 361
             ....|..|.|||.:||:|||:||||.:..     |:....:   ||..:|||.:.:|:.::  |
plant   322 AENLFVSNVFHKACIEVDEEGTEAAAVSVA-----SMTKDMLLMGDFVADHPFLFTVREEKSGVI 381

  Fly   362 YFQGHFVNPEL 372
            .|.|..::|.:
plant   382 LFMGQVLDPSI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn38FNP_524956.2 Serpin 14..370 CDD:278507 109/397 (27%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 109/397 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 172 1.000 Domainoid score I1138
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H76659
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.